Brand: | Abnova |
Reference: | H00010715-M04 |
Product name: | LASS1 monoclonal antibody (M04), clone 3F9 |
Product description: | Mouse monoclonal antibody raised against a partial recombinant LASS1. |
Clone: | 3F9 |
Isotype: | IgG2a Kappa |
Gene id: | 10715 |
Gene name: | LASS1 |
Gene alias: | CerS1|LAG1|MGC90349|UOG1 |
Gene description: | LAG1 homolog, ceramide synthase 1 |
Genbank accession: | NM_021267 |
Immunogen: | LASS1 (NP_067090.1, 301 a.a. ~ 350 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | YIVAFAAKVLTGQVHELKDLREYDTAEAQSLKPSKAEKPLRNGLVKDKRF |
Protein accession: | NP_067090.1 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: |  |
Quality control testing picture note: | Western Blot detection against Immunogen (31.24 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: |  |
Application image note: | LASS1 monoclonal antibody (M04), clone 3F9. Western Blot analysis of LASS1 expression in HepG2. |
Applications: | WB-Ce,S-ELISA,ELISA,WB-Re |
Shipping condition: | Dry Ice |