LASS1 monoclonal antibody (M04), clone 3F9 View larger

LASS1 monoclonal antibody (M04), clone 3F9

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of LASS1 monoclonal antibody (M04), clone 3F9

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsWB-Ce,S-ELISA,ELISA,WB-Re

More info about LASS1 monoclonal antibody (M04), clone 3F9

Brand: Abnova
Reference: H00010715-M04
Product name: LASS1 monoclonal antibody (M04), clone 3F9
Product description: Mouse monoclonal antibody raised against a partial recombinant LASS1.
Clone: 3F9
Isotype: IgG2a Kappa
Gene id: 10715
Gene name: LASS1
Gene alias: CerS1|LAG1|MGC90349|UOG1
Gene description: LAG1 homolog, ceramide synthase 1
Genbank accession: NM_021267
Immunogen: LASS1 (NP_067090.1, 301 a.a. ~ 350 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: YIVAFAAKVLTGQVHELKDLREYDTAEAQSLKPSKAEKPLRNGLVKDKRF
Protein accession: NP_067090.1
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00010715-M04-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (31.24 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00010715-M04-1-12-1.jpg
Application image note: LASS1 monoclonal antibody (M04), clone 3F9. Western Blot analysis of LASS1 expression in HepG2.
Applications: WB-Ce,S-ELISA,ELISA,WB-Re
Shipping condition: Dry Ice

Reviews

Buy LASS1 monoclonal antibody (M04), clone 3F9 now

Add to cart