LASS1 monoclonal antibody (M01), clone 2E8 View larger

LASS1 monoclonal antibody (M01), clone 2E8

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of LASS1 monoclonal antibody (M01), clone 2E8

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsELISA,WB-Re

More info about LASS1 monoclonal antibody (M01), clone 2E8

Brand: Abnova
Reference: H00010715-M01
Product name: LASS1 monoclonal antibody (M01), clone 2E8
Product description: Mouse monoclonal antibody raised against a partial recombinant LASS1.
Clone: 2E8
Isotype: IgG2a Kappa
Gene id: 10715
Gene name: LASS1
Gene alias: CerS1|LAG1|MGC90349|UOG1
Gene description: LAG1 homolog, ceramide synthase 1
Genbank accession: NM_021267
Immunogen: LASS1 (NP_067090.1, 301 a.a. ~ 350 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: YIVAFAAKVLTGQVHELKDLREYDTAEAQSLKPSKAEKPLRNGLVKDKRF
Protein accession: NP_067090.1
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00010715-M01-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (31.24 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Applications: ELISA,WB-Re
Shipping condition: Dry Ice

Reviews

Buy LASS1 monoclonal antibody (M01), clone 2E8 now

Add to cart