Brand: | Abnova |
Reference: | H00010714-A01 |
Product name: | POLD3 polyclonal antibody (A01) |
Product description: | Mouse polyclonal antibody raised against a partial recombinant POLD3. |
Gene id: | 10714 |
Gene name: | POLD3 |
Gene alias: | KIAA0039|MGC119642|MGC119643|P66|P68 |
Gene description: | polymerase (DNA-directed), delta 3, accessory subunit |
Genbank accession: | NM_006591 |
Immunogen: | POLD3 (NP_006582, 357 a.a. ~ 466 a.a) partial recombinant protein with GST tag. |
Immunogen sequence/protein sequence: | PPLEPVPKTEPEPPSVKSSSGENKRKRKRVLKSKTYLDGEGCIVTEKVYESESCTDSEEELNMKTSSVHRPPAMTVKKEPREERKGPKKGTAALGKANRQVSITGFFQRK |
Protein accession: | NP_006582 |
Storage buffer: | 50 % glycerol |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: |  |
Quality control testing picture note: | Western Blot detection against Immunogen (38.21 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Applications: | ELISA,WB-Re |
Shipping condition: | Dry Ice |