USP39 monoclonal antibody (M07), clone 4G11 View larger

USP39 monoclonal antibody (M07), clone 4G11

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of USP39 monoclonal antibody (M07), clone 4G11

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsS-ELISA,ELISA,WB-Re

More info about USP39 monoclonal antibody (M07), clone 4G11

Brand: Abnova
Reference: H00010713-M07
Product name: USP39 monoclonal antibody (M07), clone 4G11
Product description: Mouse monoclonal antibody raised against a partial recombinant USP39.
Clone: 4G11
Isotype: IgG2a Kappa
Gene id: 10713
Gene name: USP39
Gene alias: CGI-21|HSPC332|MGC75069|SAD1|SNRNP65
Gene description: ubiquitin specific peptidase 39
Genbank accession: NM_006590
Immunogen: USP39 (NP_006581, 466 a.a. ~ 565 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: KNPTIVNFPITNVDLREYLSEEVQAVHKNTTYDLIANIVHDGKPSEGSYRIHVLHHGTGKWYELQDLQVTDILPQMITLSEAYIQIWKRRDNDETNQQGA
Protein accession: NP_006581
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00010713-M07-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (36.74 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00010713-M07-9-20-1.jpg
Application image note: Detection limit for recombinant GST tagged USP39 is approximately 0.3ng/ml as a capture antibody.
Applications: S-ELISA,ELISA,WB-Re
Shipping condition: Dry Ice

Reviews

Buy USP39 monoclonal antibody (M07), clone 4G11 now

Add to cart