GMEB1 monoclonal antibody (M01), clone 2A8 View larger

GMEB1 monoclonal antibody (M01), clone 2A8

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of GMEB1 monoclonal antibody (M01), clone 2A8

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsWB-Ce,IHC-P,IF,S-ELISA,ELISA,WB-Re

More info about GMEB1 monoclonal antibody (M01), clone 2A8

Brand: Abnova
Reference: H00010691-M01
Product name: GMEB1 monoclonal antibody (M01), clone 2A8
Product description: Mouse monoclonal antibody raised against a partial recombinant GMEB1.
Clone: 2A8
Isotype: IgG2a Kappa
Gene id: 10691
Gene name: GMEB1
Gene alias: P96PIF|PIF96
Gene description: glucocorticoid modulatory element binding protein 1
Genbank accession: NM_024482
Immunogen: GMEB1 (NP_077808, 467 a.a. ~ 563 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: TAMQDGSTLGNMTTMVSPVELVAMESGLTSAIQAVESTSEDGQTIIEIDPAPDPEAEDTEGKAVILETELRTEEKVVAEMEEHQHQVHNVEIVVLED
Protein accession: NP_077808
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00010691-M01-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (36.41 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00010691-M01-3-7-1-L.jpg
Application image note: Immunoperoxidase of monoclonal antibody to GMEB1 on formalin-fixed paraffin-embedded human colon. [antibody concentration 3 ug/ml]
Applications: WB-Ce,IHC-P,IF,S-ELISA,ELISA,WB-Re
Shipping condition: Dry Ice

Reviews

Buy GMEB1 monoclonal antibody (M01), clone 2A8 now

Add to cart