Brand | Abnova |
Product type | Primary antibodies |
Reactivity | Human |
Host species | Mouse |
Applications | S-ELISA,ELISA,WB-Re,WB-Tr |
Brand: | Abnova |
Reference: | H00010686-M02 |
Product name: | CLDN16 monoclonal antibody (M02), clone 1F2 |
Product description: | Mouse monoclonal antibody raised against a partial recombinant CLDN16. |
Clone: | 1F2 |
Isotype: | IgG2a Kappa |
Gene id: | 10686 |
Gene name: | CLDN16 |
Gene alias: | HOMG3|PCLN1 |
Gene description: | claudin 16 |
Genbank accession: | NM_006580 |
Immunogen: | CLDN16 (NP_006571, 1 a.a. ~ 73 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | MTSRTPLLVTACLYYSYCNSRHLQQGVRKSKRPVFSHCQVPETQKTDTRHLSGARAGVCPCCHPDGLLATMRD |
Protein accession: | NP_006571 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: | ![]() |
Quality control testing picture note: | Western Blot detection against Immunogen (33.77 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: | ![]() |
Application image note: | Western Blot analysis of CLDN16 expression in transfected 293T cell line by CLDN16 monoclonal antibody (M02), clone 1F2. Lane 1: CLDN16 transfected lysate(33.8 KDa). Lane 2: Non-transfected lysate. |
Applications: | S-ELISA,ELISA,WB-Re,WB-Tr |
Shipping condition: | Dry Ice |