CLDN16 monoclonal antibody (M02), clone 1F2 View larger

CLDN16 monoclonal antibody (M02), clone 1F2

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of CLDN16 monoclonal antibody (M02), clone 1F2

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsS-ELISA,ELISA,WB-Re,WB-Tr

More info about CLDN16 monoclonal antibody (M02), clone 1F2

Brand: Abnova
Reference: H00010686-M02
Product name: CLDN16 monoclonal antibody (M02), clone 1F2
Product description: Mouse monoclonal antibody raised against a partial recombinant CLDN16.
Clone: 1F2
Isotype: IgG2a Kappa
Gene id: 10686
Gene name: CLDN16
Gene alias: HOMG3|PCLN1
Gene description: claudin 16
Genbank accession: NM_006580
Immunogen: CLDN16 (NP_006571, 1 a.a. ~ 73 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: MTSRTPLLVTACLYYSYCNSRHLQQGVRKSKRPVFSHCQVPETQKTDTRHLSGARAGVCPCCHPDGLLATMRD
Protein accession: NP_006571
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00010686-M02-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (33.77 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00010686-M02-13-15-1.jpg
Application image note: Western Blot analysis of CLDN16 expression in transfected 293T cell line by CLDN16 monoclonal antibody (M02), clone 1F2.

Lane 1: CLDN16 transfected lysate(33.8 KDa).
Lane 2: Non-transfected lysate.
Applications: S-ELISA,ELISA,WB-Re,WB-Tr
Shipping condition: Dry Ice

Reviews

Buy CLDN16 monoclonal antibody (M02), clone 1F2 now

Add to cart