B3GNT2 monoclonal antibody (M05), clone 1A8 View larger

B3GNT2 monoclonal antibody (M05), clone 1A8

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of B3GNT2 monoclonal antibody (M05), clone 1A8

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsS-ELISA,ELISA,WB-Re,WB-Tr

More info about B3GNT2 monoclonal antibody (M05), clone 1A8

Brand: Abnova
Reference: H00010678-M05
Product name: B3GNT2 monoclonal antibody (M05), clone 1A8
Product description: Mouse monoclonal antibody raised against a partial recombinant B3GNT2.
Clone: 1A8
Isotype: IgG2a Kappa
Gene id: 10678
Gene name: B3GNT2
Gene alias: B3GN-T1|B3GN-T2|B3GNT|B3GNT-2|B3GNT1|BETA3GNT
Gene description: UDP-GlcNAc:betaGal beta-1,3-N-acetylglucosaminyltransferase 2
Genbank accession: NM_006577
Immunogen: B3GNT2 (NP_006568, 111 a.a. ~ 210 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: NLPDRFKDFLLYLRCRNYSLLIDQPDKCAKKPFLLLAIKSLTPHFARRQAIRESWGQESNAGNQTVVRVFLLGQTPPEDNHPDLSDMLKFESEKHQDILM
Protein accession: NP_006568
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00010678-M05-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (36.74 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00010678-M05-13-15-1.jpg
Application image note: Western Blot analysis of B3GNT2 expression in transfected 293T cell line by B3GNT2 monoclonal antibody (M05), clone 1A8.

Lane 1: B3GNT2 transfected lysate(46.022 KDa).
Lane 2: Non-transfected lysate.
Applications: S-ELISA,ELISA,WB-Re,WB-Tr
Shipping condition: Dry Ice

Reviews

Buy B3GNT2 monoclonal antibody (M05), clone 1A8 now

Add to cart