Brand | Abnova |
Product type | Primary antibodies |
Reactivity | Human |
Host species | Mouse |
Applications | S-ELISA,ELISA,WB-Re,WB-Tr |
Brand: | Abnova |
Reference: | H00010678-M05 |
Product name: | B3GNT2 monoclonal antibody (M05), clone 1A8 |
Product description: | Mouse monoclonal antibody raised against a partial recombinant B3GNT2. |
Clone: | 1A8 |
Isotype: | IgG2a Kappa |
Gene id: | 10678 |
Gene name: | B3GNT2 |
Gene alias: | B3GN-T1|B3GN-T2|B3GNT|B3GNT-2|B3GNT1|BETA3GNT |
Gene description: | UDP-GlcNAc:betaGal beta-1,3-N-acetylglucosaminyltransferase 2 |
Genbank accession: | NM_006577 |
Immunogen: | B3GNT2 (NP_006568, 111 a.a. ~ 210 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | NLPDRFKDFLLYLRCRNYSLLIDQPDKCAKKPFLLLAIKSLTPHFARRQAIRESWGQESNAGNQTVVRVFLLGQTPPEDNHPDLSDMLKFESEKHQDILM |
Protein accession: | NP_006568 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: | ![]() |
Quality control testing picture note: | Western Blot detection against Immunogen (36.74 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: | ![]() |
Application image note: | Western Blot analysis of B3GNT2 expression in transfected 293T cell line by B3GNT2 monoclonal antibody (M05), clone 1A8. Lane 1: B3GNT2 transfected lysate(46.022 KDa). Lane 2: Non-transfected lysate. |
Applications: | S-ELISA,ELISA,WB-Re,WB-Tr |
Shipping condition: | Dry Ice |