Brand: | Abnova |
Reference: | H00010675-M02 |
Product name: | CSPG5 monoclonal antibody (M02), clone 4G6 |
Product description: | Mouse monoclonal antibody raised against a partial recombinant CSPG5. |
Clone: | 4G6 |
Isotype: | IgG1 Kappa |
Gene id: | 10675 |
Gene name: | CSPG5 |
Gene alias: | MGC44034|NGC |
Gene description: | chondroitin sulfate proteoglycan 5 (neuroglycan C) |
Genbank accession: | NM_006574 |
Immunogen: | CSPG5 (NP_006565, 445 a.a. ~ 539 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | KKLYLLKTENTKLRRTNKFRTPSELHNDNFSLSTIAEGSHPNDDPSAPHKIQEVLKSCLKEEESFNIQNSMSPKLEGGKGDQADLDVNCLQNNLT |
Protein accession: | NP_006565 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: |  |
Quality control testing picture note: | Western Blot detection against Immunogen (36.19 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: |  |
Application image note: | Detection limit for recombinant GST tagged CSPG5 is 0.03 ng/ml as a capture antibody. |
Applications: | S-ELISA,ELISA,WB-Re |
Shipping condition: | Dry Ice |