CSPG5 monoclonal antibody (M01), clone 5C11 View larger

CSPG5 monoclonal antibody (M01), clone 5C11

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of CSPG5 monoclonal antibody (M01), clone 5C11

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsS-ELISA,ELISA,WB-Re

More info about CSPG5 monoclonal antibody (M01), clone 5C11

Brand: Abnova
Reference: H00010675-M01
Product name: CSPG5 monoclonal antibody (M01), clone 5C11
Product description: Mouse monoclonal antibody raised against a partial recombinant CSPG5.
Clone: 5C11
Isotype: IgG1 Kappa
Gene id: 10675
Gene name: CSPG5
Gene alias: MGC44034|NGC
Gene description: chondroitin sulfate proteoglycan 5 (neuroglycan C)
Genbank accession: NM_006574
Immunogen: CSPG5 (NP_006565, 445 a.a. ~ 539 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: KKLYLLKTENTKLRRTNKFRTPSELHNDNFSLSTIAEGSHPNDDPSAPHKIQEVLKSCLKEEESFNIQNSMSPKLEGGKGDQADLDVNCLQNNLT
Protein accession: NP_006565
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00010675-M01-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (36.19 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00010675-M01-9-19-1.jpg
Application image note: Detection limit for recombinant GST tagged CSPG5 is approximately 1ng/ml as a capture antibody.
Applications: S-ELISA,ELISA,WB-Re
Shipping condition: Dry Ice

Reviews

Buy CSPG5 monoclonal antibody (M01), clone 5C11 now

Add to cart