Brand: | Abnova |
Reference: | H00010673-M19 |
Product name: | TNFSF13B monoclonal antibody (M19), clone 3G6 |
Product description: | Mouse monoclonal antibody raised against a partial recombinant TNFSF13B. |
Clone: | 3G6 |
Isotype: | IgG2a Kappa |
Gene id: | 10673 |
Gene name: | TNFSF13B |
Gene alias: | BAFF|BLYS|CD257|DTL|TALL-1|TALL1|THANK|TNFSF20|ZTNF4 |
Gene description: | tumor necrosis factor (ligand) superfamily, member 13b |
Genbank accession: | BC020674 |
Immunogen: | TNFSF13B (AAH20674.1, 118 a.a. ~ 222 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | PAPGEGNSSQNSRNKRAVQGPEETVTQDCLQLIADSETPTIQKGSYTFVPWLLSFKRGSALEEKENKILVKETGYFFIYGQVLYTDKTYAMGHLIQRKKVHVFGD |
Protein accession: | AAH20674.1 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: |  |
Quality control testing picture note: | Western Blot detection against Immunogen (37.18 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: |  |
Application image note: | Detection limit for recombinant GST tagged TNFSF13B is 0.3 ng/ml as a capture antibody. |
Applications: | S-ELISA,ELISA,WB-Re,IP |
Shipping condition: | Dry Ice |