TNFSF13B monoclonal antibody (M19), clone 3G6 View larger

TNFSF13B monoclonal antibody (M19), clone 3G6

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of TNFSF13B monoclonal antibody (M19), clone 3G6

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsS-ELISA,ELISA,WB-Re,IP

More info about TNFSF13B monoclonal antibody (M19), clone 3G6

Brand: Abnova
Reference: H00010673-M19
Product name: TNFSF13B monoclonal antibody (M19), clone 3G6
Product description: Mouse monoclonal antibody raised against a partial recombinant TNFSF13B.
Clone: 3G6
Isotype: IgG2a Kappa
Gene id: 10673
Gene name: TNFSF13B
Gene alias: BAFF|BLYS|CD257|DTL|TALL-1|TALL1|THANK|TNFSF20|ZTNF4
Gene description: tumor necrosis factor (ligand) superfamily, member 13b
Genbank accession: BC020674
Immunogen: TNFSF13B (AAH20674.1, 118 a.a. ~ 222 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: PAPGEGNSSQNSRNKRAVQGPEETVTQDCLQLIADSETPTIQKGSYTFVPWLLSFKRGSALEEKENKILVKETGYFFIYGQVLYTDKTYAMGHLIQRKKVHVFGD
Protein accession: AAH20674.1
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00010673-M19-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (37.18 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00010673-M19-9-20-1.jpg
Application image note: Detection limit for recombinant GST tagged TNFSF13B is 0.3 ng/ml as a capture antibody.
Applications: S-ELISA,ELISA,WB-Re,IP
Shipping condition: Dry Ice

Reviews

Buy TNFSF13B monoclonal antibody (M19), clone 3G6 now

Add to cart