CD226 monoclonal antibody (M04), clone 4G8 View larger

CD226 monoclonal antibody (M04), clone 4G8

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of CD226 monoclonal antibody (M04), clone 4G8

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsS-ELISA,ELISA

More info about CD226 monoclonal antibody (M04), clone 4G8

Brand: Abnova
Reference: H00010666-M04
Product name: CD226 monoclonal antibody (M04), clone 4G8
Product description: Mouse monoclonal antibody raised against a partial recombinant CD226.
Clone: 4G8
Isotype: IgG2a Kappa
Gene id: 10666
Gene name: CD226
Gene alias: DNAM-1|DNAM1|PTA1|TLiSA1
Gene description: CD226 molecule
Genbank accession: NM_006566
Immunogen: CD226 (NP_006557, 21 a.a. ~ 127 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: VLWHTSVPFAENMSLECVYPSMGILTQVEWFKIGTQQDSIAIFSPTHGMVIRKPYAERVYFLNSTMASNNMTLFFRNASEDDVGYYSCSLYTYPQGTWQKVIQVVQS
Protein accession: NP_006557
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00010666-M04-9-19-1.jpg
Application image note: Detection limit for recombinant GST tagged CD226 is 1 ng/ml as a capture antibody.
Applications: S-ELISA,ELISA
Shipping condition: Dry Ice

Reviews

Buy CD226 monoclonal antibody (M04), clone 4G8 now

Add to cart