Brand: | Abnova |
Reference: | H00010661-M04 |
Product name: | KLF1 monoclonal antibody (M04), clone 5G12 |
Product description: | Mouse monoclonal antibody raised against a partial recombinant KLF1. |
Clone: | 5G12 |
Isotype: | IgG3 Kappa |
Gene id: | 10661 |
Gene name: | KLF1 |
Gene alias: | EKLF |
Gene description: | Kruppel-like factor 1 (erythroid) |
Genbank accession: | NM_006563 |
Immunogen: | KLF1 (NP_006554, 183 a.a. ~ 237 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | PRTGLSVPAASGAPYGLLSGYPAMYPAPQYQGHFQLFRGLQGPAPGPATSPSFLS |
Protein accession: | NP_006554 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: |  |
Quality control testing picture note: | Western Blot detection against Immunogen (31.79 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: |  |
Application image note: | Immunofluorescence of monoclonal antibody to KLF1 on HeLa cell. [antibody concentration 10 ug/ml] |
Applications: | IF,S-ELISA,ELISA,WB-Re |
Shipping condition: | Dry Ice |