LBX1 monoclonal antibody (M12), clone 2G11 View larger

LBX1 monoclonal antibody (M12), clone 2G11

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of LBX1 monoclonal antibody (M12), clone 2G11

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsELISA,WB-Re

More info about LBX1 monoclonal antibody (M12), clone 2G11

Brand: Abnova
Reference: H00010660-M12
Product name: LBX1 monoclonal antibody (M12), clone 2G11
Product description: Mouse monoclonal antibody raised against a full length recombinant LBX1.
Clone: 2G11
Isotype: IgG2a Kappa
Gene id: 10660
Gene name: LBX1
Gene alias: HPX-6|HPX6|LBX1H|homeobox
Gene description: ladybird homeobox 1
Genbank accession: NM_006562
Immunogen: LBX1 (NP_006553, 99 a.a. ~ 199 a.a) full length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: LEVSVLQAAEGRDGMTIFGQRQTPKKRRKSRTAFTNHQIYELEKRFLYQKYLSPADRDQIAQQLGLTNAQVITWFQNRRAKLKRDLEEMKADVESAKKLGP
Protein accession: NP_006553
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00010660-M12-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (37.11 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Applications: ELISA,WB-Re
Shipping condition: Dry Ice

Reviews

Buy LBX1 monoclonal antibody (M12), clone 2G11 now

Add to cart