Brand: | Abnova |
Reference: | H00010660-M05 |
Product name: | LBX1 monoclonal antibody (M05), clone 3G6 |
Product description: | Mouse monoclonal antibody raised against a full length recombinant LBX1. |
Clone: | 3G6 |
Isotype: | IgG2a Kappa |
Gene id: | 10660 |
Gene name: | LBX1 |
Gene alias: | HPX-6|HPX6|LBX1H|homeobox |
Gene description: | ladybird homeobox 1 |
Genbank accession: | NM_006562 |
Immunogen: | LBX1 (NP_006553.2, 133 a.a. ~ 219 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | TNHQIYELEKRFLYQKYLSPADRDQIAQQLGLTNAQVITWFQNRRAKLKRDLEEMKADVESAKKLGPSGQMDIVALAELEQNSEATA |
Protein accession: | NP_006553.2 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: |  |
Quality control testing picture note: | Western Blot detection against Immunogen (35.2 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Applications: | ELISA,WB-Re |
Shipping condition: | Dry Ice |