Cart 0 Product Products (empty)
No products
To be determined Shipping
0,00 € Total
Prices are tax excluded
Product successfully added to your shopping cart
Quantity
Total
There are 0 items in your cart. There is 1 item in your cart.
Total products (tax excl.)
Total shipping (tax excl.) To be determined
Total (tax excl.)
Data sheet of CUGBP1 purified MaxPab rabbit polyclonal antibody (D01P)
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human,Mouse |
| Host species | Rabbit |
| Applications | WB-Ti,WB-Tr |
More info about CUGBP1 purified MaxPab rabbit polyclonal antibody (D01P)
| Brand: | Abnova |
| Reference: | H00010658-D01P |
| Product name: | CUGBP1 purified MaxPab rabbit polyclonal antibody (D01P) |
| Product description: | Rabbit polyclonal antibody raised against a full-length human CUGBP1 protein. |
| Gene id: | 10658 |
| Gene name: | CUGBP1 |
| Gene alias: | BRUNOL2|CUG-BP|CUGBP|NAB50|hNab50 |
| Gene description: | CUG triplet repeat, RNA binding protein 1 |
| Genbank accession: | NM_198700 |
| Immunogen: | CUGBP1 (NP_941989.1, 1 a.a. ~ 483 a.a) full-length human protein. |
| Immunogen sequence/protein sequence: | MNGTLDHPDQPDLDAIKMFVGQVPRTWSEKDLRELFEQYGAVYEINVLRDRSQNPPQSKGCCFVTFYTRKAALEAQNALHNMKVLPGMHHPIQMKPADSEKNNAVEDRKLFIGMISKKCTENDIRVMFSSFGQIEECRILRGPDGLSRGCAFVTFTTRAMAQTAIKAMHQAQTMEGCSSPMVVKFADTQKDKEQKRMAQQLQQQMQQISAASVWGNLAGLNTLGPQYLALLQQTASSGNLNTLSSLHPMGGLNAMQLQNLAALAAAASAAQNTPSGTNALTTSSSPLSVLTSSAGSSPSSSSSNSVNPIASLGALQTLAGATAGLNVGSLAGMAALNGGLGSSGLSNGTGSTMEALTQAYSGIQQYAAAALPTLYNQNLLTQQSIGAAGSQKEGPEGANLFIYHLPQEFGDQDLLQMFMPFGNVVSAKVFIDKQTNLSKCFGFVSYDNPVSAQAAIQSMNGFQIGMKRLKVQLKRSKNDSKPY |
| Protein accession: | NP_941989.1 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody reactive against mammalian transfected lysate. |
| Product type: | Primary antibodies |
| Host species: | Rabbit |
| Antigen species / target species: | Human |
| Reactivity: | Human,Mouse |
| Application image: |  |
| Application image note: | Western Blot analysis of CUGBP1 expression in transfected 293T cell line (H00010658-T02) by CUGBP1 MaxPab polyclonal antibody. Lane 1: CUGBP1 transfected lysate(51.60 KDa). Lane 2: Non-transfected lysate. |
| Applications: | WB-Ti,WB-Tr |
| Shipping condition: | Dry Ice |