Brand: | Abnova |
Reference: | H00010657-P01 |
Product name: | KHDRBS1 (Human) Recombinant Protein (P01) |
Product description: | Human KHDRBS1 full-length ORF ( AAH10132.1, 1 a.a. - 381 a.a.) recombinant protein with GST-tag at N-terminal. |
Gene id: | 10657 |
Gene name: | KHDRBS1 |
Gene alias: | FLJ34027|Sam68|p62 |
Gene description: | KH domain containing, RNA binding, signal transduction associated 1 |
Genbank accession: | BC010132.2 |
Immunogen sequence/protein sequence: | MQRRDDPAARMSRSSGRSGSMDPSGAHPSVRQTPSRQPPLPHRSRGGGGGSRGGARASPATQPPPLLPPSATGPDATVGGPAPTPLLPPSATASVKMEPENKYLPELMAEKDSLDPSFTHAMQLLTAEIEKIQKGDSKKDDEENYLDLFSHKNMKLKERVLIPVKQYPKFNFVGKILGPQGNTIKRLQEETGAKISVLGKGSMRDKAKEEELRKGGDPKYAHLNMDLHVFIEVFGPPCEAYALMAHAMEEVKKFLVPDMMDDICQEQFLELSYLNGVPEPSRGRGVPVRGRGAAPPPPPVPRGRGVGPPRGALVRGTPVRGAITRGATVTRGVPPPPTVRGAPAPRARTAGIQRIPLPPPPAPETYEEYVRNLNNVPFPST |
Protein accession: | AAH10132.1 |
Preparation method: | in vitro wheat germ expression system |
Storage buffer: | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Storage instruction: | Store at -80°C. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | 12.5% SDS-PAGE Stained with Coomassie Blue. |
Quality control testing picture: | ![qc_test-H00010657-P01-1.jpg](http://www.abnova.com/qc_test_image/qc_test-H00010657-P01-1.jpg) |
Note: | Best use within three months from the date of receipt of this protein. |
Tag: | GST |
Product type: | Proteins |
Host species: | Wheat Germ (in vitro) |
Antigen species / target species: | Human |
Applications: | AP,Array,ELISA,WB-Re |
Shipping condition: | Dry Ice |
Publications: | The nuclear protein Sam68 is cleaved by the FMDV 3C protease redistributing Sam68 to the cytoplasm during FMDV infection of host cells.Lawrence P, Schafer EA, Rieder E. Virology. 2012 Mar 30;425(1):40-52. Epub 2012 Jan 26. |