Brand: | Abnova |
Reference: | H00010657-M03 |
Product name: | KHDRBS1 monoclonal antibody (M03), clone 1A4 |
Product description: | Mouse monoclonal antibody raised against a partial recombinant KHDRBS1. |
Clone: | 1A4 |
Isotype: | IgG2a Kappa |
Gene id: | 10657 |
Gene name: | KHDRBS1 |
Gene alias: | FLJ34027|Sam68|p62 |
Gene description: | KH domain containing, RNA binding, signal transduction associated 1 |
Genbank accession: | BC000717 |
Immunogen: | KHDRBS1 (AAH00717, 176 a.a. ~ 275 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | ILGPQGNTIKRLQEETGAKISVLGKGSMRDKAKEEELRKGGDPKYAHLNMDLHVFIEVFGPPCEAYALMAHAMEEVKKFLVPDMMDDICQEQFLELSYLN |
Protein accession: | AAH00717 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: |  |
Quality control testing picture note: | Western Blot detection against Immunogen (36.63 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: |  |
Application image note: | Immunoperoxidase of monoclonal antibody to KHDRBS1 on formalin-fixed paraffin-embedded human liver. [antibody concentration 3 ug/ml] |
Applications: | WB-Ce,IHC-P,IF,S-ELISA,ELISA,WB-Re,WB-Tr |
Shipping condition: | Dry Ice |