KHDRBS1 monoclonal antibody (M03), clone 1A4 View larger

KHDRBS1 monoclonal antibody (M03), clone 1A4

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of KHDRBS1 monoclonal antibody (M03), clone 1A4

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsWB-Ce,IHC-P,IF,S-ELISA,ELISA,WB-Re,WB-Tr

More info about KHDRBS1 monoclonal antibody (M03), clone 1A4

Brand: Abnova
Reference: H00010657-M03
Product name: KHDRBS1 monoclonal antibody (M03), clone 1A4
Product description: Mouse monoclonal antibody raised against a partial recombinant KHDRBS1.
Clone: 1A4
Isotype: IgG2a Kappa
Gene id: 10657
Gene name: KHDRBS1
Gene alias: FLJ34027|Sam68|p62
Gene description: KH domain containing, RNA binding, signal transduction associated 1
Genbank accession: BC000717
Immunogen: KHDRBS1 (AAH00717, 176 a.a. ~ 275 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: ILGPQGNTIKRLQEETGAKISVLGKGSMRDKAKEEELRKGGDPKYAHLNMDLHVFIEVFGPPCEAYALMAHAMEEVKKFLVPDMMDDICQEQFLELSYLN
Protein accession: AAH00717
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00010657-M03-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (36.63 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00010657-M03-3-8-1-L.jpg
Application image note: Immunoperoxidase of monoclonal antibody to KHDRBS1 on formalin-fixed paraffin-embedded human liver. [antibody concentration 3 ug/ml]
Applications: WB-Ce,IHC-P,IF,S-ELISA,ELISA,WB-Re,WB-Tr
Shipping condition: Dry Ice

Reviews

Buy KHDRBS1 monoclonal antibody (M03), clone 1A4 now

Add to cart