KHDRBS1 MaxPab mouse polyclonal antibody (B01) View larger

KHDRBS1 MaxPab mouse polyclonal antibody (B01)

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of KHDRBS1 MaxPab mouse polyclonal antibody (B01)

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsIF,WB-Tr

More info about KHDRBS1 MaxPab mouse polyclonal antibody (B01)

Brand: Abnova
Reference: H00010657-B01
Product name: KHDRBS1 MaxPab mouse polyclonal antibody (B01)
Product description: Mouse polyclonal antibody raised against a full-length human KHDRBS1 protein.
Gene id: 10657
Gene name: KHDRBS1
Gene alias: FLJ34027|Sam68|p62
Gene description: KH domain containing, RNA binding, signal transduction associated 1
Genbank accession: BC010132
Immunogen: KHDRBS1 (AAH10132, 1 a.a. ~ 381 a.a) full-length human protein.
Immunogen sequence/protein sequence: MQRRDDPAARMSRSSGRSGSMDPSGAHPSVRQTPSRQPPLPHRSRGGGGGSRGGARASPATQPPPLLPPSATGPDATVGGPAPTPLLPPSATASVKMEPENKYLPELMAEKDSLDPSFTHAMQLLTAEIEKIQKGDSKKDDEENYLDLFSHKNMKLKERVLIPVKQYPKFNFVGKILGPQGNTIKRLQEETGAKISVLGKGSMRDKAKEEELRKGGDPKYAHLNMDLHVFIEVFGPPCEAYALMAHAMEEVKKFLVPDMMDDICQEQFLELSYLNGVPEPSRGRGVPVRGRGAAPPPPPVPRGRGVGPPRGALVRGTPVRGAITRGATVTRGVPPPPTVRGAPAPRARTAGIQRIPLPPPPAPETYEEYVRNLNNVPFPST
Protein accession: AAH10132
Storage buffer: No additive
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody reactive against mammalian transfected lysate.
Note: For IHC and IF applications, antibody purification with Protein A will be needed prior to use.
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00010657-B01-13-15-1.jpg
Application image note: Western Blot analysis of KHDRBS1 expression in transfected 293T cell line (H00010657-T01) by KHDRBS1 MaxPab polyclonal antibody.

Lane 1: KHDRBS1 transfected lysate(41.91 KDa).
Lane 2: Non-transfected lysate.
Applications: IF,WB-Tr
Shipping condition: Dry Ice

Reviews

Buy KHDRBS1 MaxPab mouse polyclonal antibody (B01) now

Add to cart