CAMKK2 monoclonal antibody (M02), clone 4C7 View larger

CAMKK2 monoclonal antibody (M02), clone 4C7

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of CAMKK2 monoclonal antibody (M02), clone 4C7

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsWB-Ce,S-ELISA,ELISA,WB-Re

More info about CAMKK2 monoclonal antibody (M02), clone 4C7

Brand: Abnova
Reference: H00010645-M02
Product name: CAMKK2 monoclonal antibody (M02), clone 4C7
Product description: Mouse monoclonal antibody raised against a partial recombinant CAMKK2.
Clone: 4C7
Isotype: IgG1 Kappa
Gene id: 10645
Gene name: CAMKK2
Gene alias: CAMKK|CAMKKB|KIAA0787|MGC15254
Gene description: calcium/calmodulin-dependent protein kinase kinase 2, beta
Genbank accession: BC026060
Immunogen: CAMKK2 (AAH26060, 1 a.a. ~ 130 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: MSSCVSSQPSSNRAAPQDELGGRGSSSSESQKPCEALRGLSSLSIHLGMESFIVVTECEPGCAVDLGLARDRPLEADGQEVPLDSSGSQARPHLSGRKLSLQERSQGGLAAGGSLDMNGRCICPSLPYSP
Protein accession: AAH26060
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00010645-M02-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (39.93 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00010645-M02-1-12-1.jpg
Application image note: CAMKK2 monoclonal antibody (M02), clone 4C7 Western Blot analysis of CAMKK2 expression in HepG2 ( Cat # L019V1 ).
Applications: WB-Ce,S-ELISA,ELISA,WB-Re
Shipping condition: Dry Ice
Publications: Regulation of Rac1 by simvastatin in endothelial cells: differential roles of AMP-activated protein kinase and calmodulin-dependent kinase kinase-beta.Kou R, Sartoretto J, Michel T.
J Biol Chem. 2009 May 29;284(22):14734-43. Epub 2009 Mar 30.

Reviews

Buy CAMKK2 monoclonal antibody (M02), clone 4C7 now

Add to cart