Brand: | Abnova |
Reference: | H00010645-M02 |
Product name: | CAMKK2 monoclonal antibody (M02), clone 4C7 |
Product description: | Mouse monoclonal antibody raised against a partial recombinant CAMKK2. |
Clone: | 4C7 |
Isotype: | IgG1 Kappa |
Gene id: | 10645 |
Gene name: | CAMKK2 |
Gene alias: | CAMKK|CAMKKB|KIAA0787|MGC15254 |
Gene description: | calcium/calmodulin-dependent protein kinase kinase 2, beta |
Genbank accession: | BC026060 |
Immunogen: | CAMKK2 (AAH26060, 1 a.a. ~ 130 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | MSSCVSSQPSSNRAAPQDELGGRGSSSSESQKPCEALRGLSSLSIHLGMESFIVVTECEPGCAVDLGLARDRPLEADGQEVPLDSSGSQARPHLSGRKLSLQERSQGGLAAGGSLDMNGRCICPSLPYSP |
Protein accession: | AAH26060 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: |  |
Quality control testing picture note: | Western Blot detection against Immunogen (39.93 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: |  |
Application image note: | CAMKK2 monoclonal antibody (M02), clone 4C7 Western Blot analysis of CAMKK2 expression in HepG2 ( Cat # L019V1 ). |
Applications: | WB-Ce,S-ELISA,ELISA,WB-Re |
Shipping condition: | Dry Ice |
Publications: | Regulation of Rac1 by simvastatin in endothelial cells: differential roles of AMP-activated protein kinase and calmodulin-dependent kinase kinase-beta.Kou R, Sartoretto J, Michel T. J Biol Chem. 2009 May 29;284(22):14734-43. Epub 2009 Mar 30. |