CAMKK2 monoclonal antibody (M01), clone 1A11 View larger

CAMKK2 monoclonal antibody (M01), clone 1A11

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of CAMKK2 monoclonal antibody (M01), clone 1A11

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsWB-Ce,S-ELISA,ELISA,WB-Re,WB-Tr,IP

More info about CAMKK2 monoclonal antibody (M01), clone 1A11

Brand: Abnova
Reference: H00010645-M01
Product name: CAMKK2 monoclonal antibody (M01), clone 1A11
Product description: Mouse monoclonal antibody raised against a partial recombinant CAMKK2.
Clone: 1A11
Isotype: IgG1 Kappa
Gene id: 10645
Gene name: CAMKK2
Gene alias: CAMKK|CAMKKB|KIAA0787|MGC15254
Gene description: calcium/calmodulin-dependent protein kinase kinase 2, beta
Genbank accession: BC026060
Immunogen: CAMKK2 (AAH26060, 1 a.a. ~ 130 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: MSSCVSSQPSSNRAAPQDELGGRGSSSSESQKPCEALRGLSSLSIHLGMESFIVVTECEPGCAVDLGLARDRPLEADGQEVPLDSSGSQARPHLSGRKLSLQERSQGGLAAGGSLDMNGRCICPSLPYSP
Protein accession: AAH26060
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00010645-M01-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (39.93 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00010645-M01-1-19-1.jpg
Application image note: CAMKK2 monoclonal antibody (M01), clone 1A11 Western Blot analysis of CAMKK2 expression in IMR-32 ( Cat # L008V1 ).
Applications: WB-Ce,S-ELISA,ELISA,WB-Re,WB-Tr,IP
Shipping condition: Dry Ice
Publications: Utilizing the Dog Genome in the Search for Novel Candidate Genes Involved in Glioma Development-Genome Wide Association Mapping followed by Targeted Massive Parallel Sequencing Identifies a Strongly Associated Locus.Truve K, Dickinson P, Xiong A, York D, Jayashankar K, Pielberg G, Koltookian M, Muren E, Fuxelius HH, Weishaupt H, Swartling FJ, Andersson G, Hedhammar A, Bongcam-Rudloff E, Forsberg-Nilsson K, Bannasch D, Lindblad-Toh K.
PLoS Genet. 2016 May 12;12(5):e1006000.

Reviews

Buy CAMKK2 monoclonal antibody (M01), clone 1A11 now

Add to cart