Cart 0 Product Products (empty)
No products
To be determined Shipping
0,00 € Total
Prices are tax excluded
Product successfully added to your shopping cart
Quantity
Total
There are 0 items in your cart. There is 1 item in your cart.
Total products (tax excl.)
Total shipping (tax excl.) To be determined
Total (tax excl.)
Data sheet of CAMKK2 monoclonal antibody (M01), clone 1A11
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human |
| Host species | Mouse |
| Applications | WB-Ce,S-ELISA,ELISA,WB-Re,WB-Tr,IP |
More info about CAMKK2 monoclonal antibody (M01), clone 1A11
| Brand: | Abnova |
| Reference: | H00010645-M01 |
| Product name: | CAMKK2 monoclonal antibody (M01), clone 1A11 |
| Product description: | Mouse monoclonal antibody raised against a partial recombinant CAMKK2. |
| Clone: | 1A11 |
| Isotype: | IgG1 Kappa |
| Gene id: | 10645 |
| Gene name: | CAMKK2 |
| Gene alias: | CAMKK|CAMKKB|KIAA0787|MGC15254 |
| Gene description: | calcium/calmodulin-dependent protein kinase kinase 2, beta |
| Genbank accession: | BC026060 |
| Immunogen: | CAMKK2 (AAH26060, 1 a.a. ~ 130 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | MSSCVSSQPSSNRAAPQDELGGRGSSSSESQKPCEALRGLSSLSIHLGMESFIVVTECEPGCAVDLGLARDRPLEADGQEVPLDSSGSQARPHLSGRKLSLQERSQGGLAAGGSLDMNGRCICPSLPYSP |
| Protein accession: | AAH26060 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: |  |
| Quality control testing picture note: | Western Blot detection against Immunogen (39.93 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: |  |
| Application image note: | CAMKK2 monoclonal antibody (M01), clone 1A11 Western Blot analysis of CAMKK2 expression in IMR-32 ( Cat # L008V1 ). |
| Applications: | WB-Ce,S-ELISA,ELISA,WB-Re,WB-Tr,IP |
| Shipping condition: | Dry Ice |
| Publications: | Utilizing the Dog Genome in the Search for Novel Candidate Genes Involved in Glioma Development-Genome Wide Association Mapping followed by Targeted Massive Parallel Sequencing Identifies a Strongly Associated Locus.Truve K, Dickinson P, Xiong A, York D, Jayashankar K, Pielberg G, Koltookian M, Muren E, Fuxelius HH, Weishaupt H, Swartling FJ, Andersson G, Hedhammar A, Bongcam-Rudloff E, Forsberg-Nilsson K, Bannasch D, Lindblad-Toh K. PLoS Genet. 2016 May 12;12(5):e1006000. |