LEFTY1 monoclonal antibody (M11), clone 3B5 View larger

LEFTY1 monoclonal antibody (M11), clone 3B5

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of LEFTY1 monoclonal antibody (M11), clone 3B5

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsELISA,WB-Re

More info about LEFTY1 monoclonal antibody (M11), clone 3B5

Brand: Abnova
Reference: H00010637-M11
Product name: LEFTY1 monoclonal antibody (M11), clone 3B5
Product description: Mouse monoclonal antibody raised against a full length recombinant LEFTY1.
Clone: 3B5
Isotype: IgG2a Kappa
Gene id: 10637
Gene name: LEFTY1
Gene alias: LEFTB|LEFTYB
Gene description: left-right determination factor 1
Genbank accession: NM_020997
Immunogen: LEFTY1 (NP_066277, 145 a.a. ~ 250 a.a) full length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: VTVEWLRVRDDGSNRTSLIDSRLVSVHESGWKAFDVTEAVNFWQQLSRPRQPLLLQVSVQREHLGPLASGAHKLVRFASQGAPAGLGEPQLELHTLDLGDYGAQGD
Protein accession: NP_066277
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00010637-M11-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (37.66 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Applications: ELISA,WB-Re
Shipping condition: Dry Ice

Reviews

Buy LEFTY1 monoclonal antibody (M11), clone 3B5 now

Add to cart