LEFTY1 monoclonal antibody (M04), clone 4A3 View larger

LEFTY1 monoclonal antibody (M04), clone 4A3

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of LEFTY1 monoclonal antibody (M04), clone 4A3

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsELISA

More info about LEFTY1 monoclonal antibody (M04), clone 4A3

Brand: Abnova
Reference: H00010637-M04
Product name: LEFTY1 monoclonal antibody (M04), clone 4A3
Product description: Mouse monoclonal antibody raised against a full length recombinant LEFTY1.
Clone: 4A3
Isotype: IgG2a Kappa
Gene id: 10637
Gene name: LEFTY1
Gene alias: LEFTB|LEFTYB
Gene description: left-right determination factor 1
Genbank accession: BC027883
Immunogen: LEFTY1 (AAH27883, 1 a.a. ~ 366 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: MQPLWLCWALWVLPLASPGAALAGEQLLGSLLRQLQLKEVPTLDRADMEELVIPTHVRAQYVALLQRSHGDRSRGKRFSQSFREVAGRFLALEASTHLLVFGMEQRLPPNSELVQAVLRLFQEPVPKAALHRHGRLSLRSARARVTVEWLRVRDDGSNRTSLIDSRLVSVHESGWKAFDVTEAVNFWQQLSRPRQPLLLQVSVQREHLGPLASGAHKLVRFASQGAPAGLGEPQLELHTLDLGDYGAQGDCDPEAPMTEGTRCCRQEMYIDLQGMKWAENWVLEPPGFLAYECVGTCRQPPEALAFKWPFLGPRQCIASETDSLPMIVSIKEGGRTRPQVVSLPNMRVQKCSCASDGALVPRRLQP
Protein accession: AAH27883
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Applications: ELISA
Shipping condition: Dry Ice

Reviews

Buy LEFTY1 monoclonal antibody (M04), clone 4A3 now

Add to cart