Brand: | Abnova |
Reference: | H00010637-M03 |
Product name: | LEFTY1 monoclonal antibody (M03), clone 2E10 |
Product description: | Mouse monoclonal antibody raised against a full length recombinant LEFTY1. |
Clone: | 2E10 |
Isotype: | IgG2a Kappa |
Gene id: | 10637 |
Gene name: | LEFTY1 |
Gene alias: | LEFTB|LEFTYB |
Gene description: | left-right determination factor 1 |
Genbank accession: | BC027883 |
Immunogen: | LEFTY1 (AAH27883, 1 a.a. ~ 366 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | MQPLWLCWALWVLPLASPGAALAGEQLLGSLLRQLQLKEVPTLDRADMEELVIPTHVRAQYVALLQRSHGDRSRGKRFSQSFREVAGRFLALEASTHLLVFGMEQRLPPNSELVQAVLRLFQEPVPKAALHRHGRLSLRSARARVTVEWLRVRDDGSNRTSLIDSRLVSVHESGWKAFDVTEAVNFWQQLSRPRQPLLLQVSVQREHLGPLASGAHKLVRFASQGAPAGLGEPQLELHTLDLGDYGAQGDCDPEAPMTEGTRCCRQEMYIDLQGMKWAENWVLEPPGFLAYECVGTCRQPPEALAFKWPFLGPRQCIASETDSLPMIVSIKEGGRTRPQVVSLPNMRVQKCSCASDGALVPRRLQP |
Protein accession: | AAH27883 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: |  |
Application image note: | LEFTY1 monoclonal antibody (M03), clone 2E10 Western Blot analysis of LEFTY1 expression in THP-1 ( Cat # L007V1 ). |
Applications: | WB-Ce,S-ELISA,ELISA |
Shipping condition: | Dry Ice |
Publications: | Identification of the role of bone morphogenetic protein (BMP) and TGF-β signaling in the trajectory of serotonergic differentiation in a rapid assay in mouse embryonic stem cells in vitro.Yamasaki A, Kasai A, Toi A, Kurita M, Kimoto S, Hayata-Takano A, Nakazawa T, Nagayasu K, Shintani N, Hashimoto R, Ito A, Meltzer HY, Ago Y, Waschek JA, Onaka Y, Matsuda T, Baba A, Hashimoto H J Neurochem. 2014 Nov 25. doi: 10.1111/jnc.12999. |