LEFTY1 monoclonal antibody (M03), clone 2E10 View larger

LEFTY1 monoclonal antibody (M03), clone 2E10

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of LEFTY1 monoclonal antibody (M03), clone 2E10

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsWB-Ce,S-ELISA,ELISA

More info about LEFTY1 monoclonal antibody (M03), clone 2E10

Brand: Abnova
Reference: H00010637-M03
Product name: LEFTY1 monoclonal antibody (M03), clone 2E10
Product description: Mouse monoclonal antibody raised against a full length recombinant LEFTY1.
Clone: 2E10
Isotype: IgG2a Kappa
Gene id: 10637
Gene name: LEFTY1
Gene alias: LEFTB|LEFTYB
Gene description: left-right determination factor 1
Genbank accession: BC027883
Immunogen: LEFTY1 (AAH27883, 1 a.a. ~ 366 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: MQPLWLCWALWVLPLASPGAALAGEQLLGSLLRQLQLKEVPTLDRADMEELVIPTHVRAQYVALLQRSHGDRSRGKRFSQSFREVAGRFLALEASTHLLVFGMEQRLPPNSELVQAVLRLFQEPVPKAALHRHGRLSLRSARARVTVEWLRVRDDGSNRTSLIDSRLVSVHESGWKAFDVTEAVNFWQQLSRPRQPLLLQVSVQREHLGPLASGAHKLVRFASQGAPAGLGEPQLELHTLDLGDYGAQGDCDPEAPMTEGTRCCRQEMYIDLQGMKWAENWVLEPPGFLAYECVGTCRQPPEALAFKWPFLGPRQCIASETDSLPMIVSIKEGGRTRPQVVSLPNMRVQKCSCASDGALVPRRLQP
Protein accession: AAH27883
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00010637-M03-1-29-1.jpg
Application image note: LEFTY1 monoclonal antibody (M03), clone 2E10 Western Blot analysis of LEFTY1 expression in THP-1 ( Cat # L007V1 ).
Applications: WB-Ce,S-ELISA,ELISA
Shipping condition: Dry Ice
Publications: Identification of the role of bone morphogenetic protein (BMP) and TGF-β signaling in the trajectory of serotonergic differentiation in a rapid assay in mouse embryonic stem cells in vitro.Yamasaki A, Kasai A, Toi A, Kurita M, Kimoto S, Hayata-Takano A, Nakazawa T, Nagayasu K, Shintani N, Hashimoto R, Ito A, Meltzer HY, Ago Y, Waschek JA, Onaka Y, Matsuda T, Baba A, Hashimoto H
J Neurochem. 2014 Nov 25. doi: 10.1111/jnc.12999.

Reviews

Buy LEFTY1 monoclonal antibody (M03), clone 2E10 now

Add to cart