LEFTY1 monoclonal antibody (M02), clone 1F9 View larger

LEFTY1 monoclonal antibody (M02), clone 1F9

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of LEFTY1 monoclonal antibody (M02), clone 1F9

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsS-ELISA,ELISA

More info about LEFTY1 monoclonal antibody (M02), clone 1F9

Brand: Abnova
Reference: H00010637-M02
Product name: LEFTY1 monoclonal antibody (M02), clone 1F9
Product description: Mouse monoclonal antibody raised against a full length recombinant LEFTY1.
Clone: 1F9
Isotype: IgG2a Kappa
Gene id: 10637
Gene name: LEFTY1
Gene alias: LEFTB|LEFTYB
Gene description: left-right determination factor 1
Genbank accession: BC027883
Immunogen: LEFTY1 (AAH27883, 1 a.a. ~ 366 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: MQPLWLCWALWVLPLASPGAALAGEQLLGSLLRQLQLKEVPTLDRADMEELVIPTHVRAQYVALLQRSHGDRSRGKRFSQSFREVAGRFLALEASTHLLVFGMEQRLPPNSELVQAVLRLFQEPVPKAALHRHGRLSLRSARARVTVEWLRVRDDGSNRTSLIDSRLVSVHESGWKAFDVTEAVNFWQQLSRPRQPLLLQVSVQREHLGPLASGAHKLVRFASQGAPAGLGEPQLELHTLDLGDYGAQGDCDPEAPMTEGTRCCRQEMYIDLQGMKWAENWVLEPPGFLAYECVGTCRQPPEALAFKWPFLGPRQCIASETDSLPMIVSIKEGGRTRPQVVSLPNMRVQKCSCASDGALVPRRLQP
Protein accession: AAH27883
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: http://www.abnova.com/application_image/
Application image note: Detection limit for recombinant GST tagged LEFTY1 is approximately 30ng/ml as a capture antibody.
Applications: S-ELISA,ELISA
Shipping condition: Dry Ice

Reviews

Buy LEFTY1 monoclonal antibody (M02), clone 1F9 now

Add to cart