LEFTY1 monoclonal antibody (M01), clone 4D7 View larger

LEFTY1 monoclonal antibody (M01), clone 4D7

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of LEFTY1 monoclonal antibody (M01), clone 4D7

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsELISA,IP

More info about LEFTY1 monoclonal antibody (M01), clone 4D7

Brand: Abnova
Reference: H00010637-M01
Product name: LEFTY1 monoclonal antibody (M01), clone 4D7
Product description: Mouse monoclonal antibody raised against a full length recombinant LEFTY1.
Clone: 4D7
Isotype: IgG2a Kappa
Gene id: 10637
Gene name: LEFTY1
Gene alias: LEFTB|LEFTYB
Gene description: left-right determination factor 1
Genbank accession: BC027883
Immunogen: LEFTY1 (AAH27883, 1 a.a. ~ 366 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: MQPLWLCWALWVLPLASPGAALAGEQLLGSLLRQLQLKEVPTLDRADMEELVIPTHVRAQYVALLQRSHGDRSRGKRFSQSFREVAGRFLALEASTHLLVFGMEQRLPPNSELVQAVLRLFQEPVPKAALHRHGRLSLRSARARVTVEWLRVRDDGSNRTSLIDSRLVSVHESGWKAFDVTEAVNFWQQLSRPRQPLLLQVSVQREHLGPLASGAHKLVRFASQGAPAGLGEPQLELHTLDLGDYGAQGDCDPEAPMTEGTRCCRQEMYIDLQGMKWAENWVLEPPGFLAYECVGTCRQPPEALAFKWPFLGPRQCIASETDSLPMIVSIKEGGRTRPQVVSLPNMRVQKCSCASDGALVPRRLQP
Protein accession: AAH27883
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00010637-M01-31-15-1.jpg
Application image note: Immunoprecipitation of LEFTY1 transfected lysate using anti-LEFTY1 monoclonal antibody and Protein A Magnetic Bead (U0007), and immunoblotted with LEFTY1 MaxPab rabbit polyclonal antibody.
Applications: ELISA,IP
Shipping condition: Dry Ice

Reviews

Buy LEFTY1 monoclonal antibody (M01), clone 4D7 now

Add to cart