TRIM16 monoclonal antibody (M01A), clone 5F4 View larger

TRIM16 monoclonal antibody (M01A), clone 5F4

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of TRIM16 monoclonal antibody (M01A), clone 5F4

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsELISA,WB-Re,WB-Tr

More info about TRIM16 monoclonal antibody (M01A), clone 5F4

Brand: Abnova
Reference: H00010626-M01A
Product name: TRIM16 monoclonal antibody (M01A), clone 5F4
Product description: Mouse monoclonal antibody raised against a partial recombinant TRIM16.
Clone: 5F4
Isotype: IgG2a Kappa
Gene id: 10626
Gene name: TRIM16
Gene alias: EBBP
Gene description: tripartite motif-containing 16
Genbank accession: NM_006470
Immunogen: TRIM16 (NP_006461, 165 a.a. ~ 273 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: LDAARRDKEAELQCTQLDLERKLKLNENAISRLQANQKSVLVSVSEVKAVAEMQFGELLAAVRKAQANVMLFLEEKEQAALSQANGIKAHLEYRSAEMEKSKQELERMA
Protein accession: NP_006461
Storage buffer: In ascites fluid
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00010626-M01A-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (37.73 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00010626-M01A-13-15-1.jpg
Application image note: Western Blot analysis of TRIM16 expression in transfected 293T cell line by TRIM16 monoclonal antibody (M01A), clone 5F4.

Lane 1: TRIM16 transfected lysate(64 KDa).
Lane 2: Non-transfected lysate.
Applications: ELISA,WB-Re,WB-Tr
Shipping condition: Dry Ice

Reviews

Buy TRIM16 monoclonal antibody (M01A), clone 5F4 now

Add to cart