Brand: | Abnova |
Reference: | H00010625-M01 |
Product name: | IVNS1ABP monoclonal antibody (M01), clone 4B1 |
Product description: | Mouse monoclonal antibody raised against a partial recombinant IVNS1ABP. |
Clone: | 4B1 |
Isotype: | IgG1 Kappa |
Gene id: | 10625 |
Gene name: | IVNS1ABP |
Gene alias: | DKFZp686K06216|FLARA3|FLJ10069|FLJ10411|FLJ10962|FLJ35593|FLJ36593|HSPC068|KIAA0850|ND1|NS-1|NS1-BP|NS1BP |
Gene description: | influenza virus NS1A binding protein |
Genbank accession: | NM_006469 |
Immunogen: | IVNS1ABP (NP_006460.2, 1 a.a. ~ 100 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | MIPNGYLMFEDENFIESSVAKLNALRKSGQFCDVRLQVCGHEMLAHRAVLACCSPYLFEIFNSDSDPHGISHVKFDDLNPEAVEVLLNYAYTAQLKADKE |
Protein accession: | NP_006460.2 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: |  |
Quality control testing picture note: | Western Blot detection against Immunogen (36.74 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: |  |
Application image note: | Detection limit for recombinant GST tagged IVNS1ABP is 3 ng/ml as a capture antibody. |
Applications: | S-ELISA,ELISA,WB-Re |
Shipping condition: | Dry Ice |