IVNS1ABP monoclonal antibody (M01), clone 4B1 View larger

IVNS1ABP monoclonal antibody (M01), clone 4B1

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of IVNS1ABP monoclonal antibody (M01), clone 4B1

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsS-ELISA,ELISA,WB-Re

More info about IVNS1ABP monoclonal antibody (M01), clone 4B1

Brand: Abnova
Reference: H00010625-M01
Product name: IVNS1ABP monoclonal antibody (M01), clone 4B1
Product description: Mouse monoclonal antibody raised against a partial recombinant IVNS1ABP.
Clone: 4B1
Isotype: IgG1 Kappa
Gene id: 10625
Gene name: IVNS1ABP
Gene alias: DKFZp686K06216|FLARA3|FLJ10069|FLJ10411|FLJ10962|FLJ35593|FLJ36593|HSPC068|KIAA0850|ND1|NS-1|NS1-BP|NS1BP
Gene description: influenza virus NS1A binding protein
Genbank accession: NM_006469
Immunogen: IVNS1ABP (NP_006460.2, 1 a.a. ~ 100 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: MIPNGYLMFEDENFIESSVAKLNALRKSGQFCDVRLQVCGHEMLAHRAVLACCSPYLFEIFNSDSDPHGISHVKFDDLNPEAVEVLLNYAYTAQLKADKE
Protein accession: NP_006460.2
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00010625-M01-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (36.74 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00010625-M01-9-18-1.jpg
Application image note: Detection limit for recombinant GST tagged IVNS1ABP is 3 ng/ml as a capture antibody.
Applications: S-ELISA,ELISA,WB-Re
Shipping condition: Dry Ice

Reviews

Buy IVNS1ABP monoclonal antibody (M01), clone 4B1 now

Add to cart