Brand: | Abnova |
Reference: | H00010618-M02 |
Product name: | TGOLN2 monoclonal antibody (M02), clone 2F11 |
Product description: | Mouse monoclonal antibody raised against a partial recombinant TGOLN2. |
Clone: | 2F11 |
Isotype: | IgG2a Kappa |
Gene id: | 10618 |
Gene name: | TGOLN2 |
Gene alias: | MGC14722|TGN38|TGN46|TGN48|TGN51|TTGN2 |
Gene description: | trans-golgi network protein 2 |
Genbank accession: | NM_006464 |
Immunogen: | TGOLN2 (NP_006455, 229 a.a. ~ 327 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | QGPIDGPSKSGAEEQTSKDSPNKVVPEQPSRKDHSKPISNPSDNKELPKADTNQLADKGKLSPHAFKTESGEETDLISPPQEEVKSSEPTEDVEPKEAE |
Protein accession: | NP_006455 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: |  |
Quality control testing picture note: | Western Blot detection against Immunogen (36.63 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: |  |
Application image note: | Immunoperoxidase of monoclonal antibody to TGOLN2 on formalin-fixed paraffin-embedded human small Intestine. [antibody concentration 3 ug/ml] |
Applications: | IHC-P,IF,S-ELISA,ELISA,WB-Re |
Shipping condition: | Dry Ice |
Publications: | Distinctive features of degenerating Purkinje cells in spinocerebellar ataxia type 31.Yoshida K, Asakawa M, Suzuki-Kouyama E, Tabata K, Shintaku M, Ikeda S, Oyanagi K Neuropathology. 2014 Jun;34(3):261-7. doi: 10.1111/neup.12090. Epub 2013 Dec 17. |