TGOLN2 monoclonal antibody (M02), clone 2F11 View larger

TGOLN2 monoclonal antibody (M02), clone 2F11

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of TGOLN2 monoclonal antibody (M02), clone 2F11

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsIHC-P,IF,S-ELISA,ELISA,WB-Re

More info about TGOLN2 monoclonal antibody (M02), clone 2F11

Brand: Abnova
Reference: H00010618-M02
Product name: TGOLN2 monoclonal antibody (M02), clone 2F11
Product description: Mouse monoclonal antibody raised against a partial recombinant TGOLN2.
Clone: 2F11
Isotype: IgG2a Kappa
Gene id: 10618
Gene name: TGOLN2
Gene alias: MGC14722|TGN38|TGN46|TGN48|TGN51|TTGN2
Gene description: trans-golgi network protein 2
Genbank accession: NM_006464
Immunogen: TGOLN2 (NP_006455, 229 a.a. ~ 327 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: QGPIDGPSKSGAEEQTSKDSPNKVVPEQPSRKDHSKPISNPSDNKELPKADTNQLADKGKLSPHAFKTESGEETDLISPPQEEVKSSEPTEDVEPKEAE
Protein accession: NP_006455
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00010618-M02-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (36.63 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00010618-M02-3-36-1-L.jpg
Application image note: Immunoperoxidase of monoclonal antibody to TGOLN2 on formalin-fixed paraffin-embedded human small Intestine. [antibody concentration 3 ug/ml]
Applications: IHC-P,IF,S-ELISA,ELISA,WB-Re
Shipping condition: Dry Ice
Publications: Distinctive features of degenerating Purkinje cells in spinocerebellar ataxia type 31.Yoshida K, Asakawa M, Suzuki-Kouyama E, Tabata K, Shintaku M, Ikeda S, Oyanagi K
Neuropathology. 2014 Jun;34(3):261-7. doi: 10.1111/neup.12090. Epub 2013 Dec 17.

Reviews

Buy TGOLN2 monoclonal antibody (M02), clone 2F11 now

Add to cart