TGOLN2 polyclonal antibody (A01) View larger

TGOLN2 polyclonal antibody (A01)

New product

286,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of TGOLN2 polyclonal antibody (A01)

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsELISA,WB-Re

More info about TGOLN2 polyclonal antibody (A01)

Brand: Abnova
Reference: H00010618-A01
Product name: TGOLN2 polyclonal antibody (A01)
Product description: Mouse polyclonal antibody raised against a partial recombinant TGOLN2.
Gene id: 10618
Gene name: TGOLN2
Gene alias: MGC14722|TGN38|TGN46|TGN48|TGN51|TTGN2
Gene description: trans-golgi network protein 2
Genbank accession: NM_006464
Immunogen: TGOLN2 (NP_006455, 229 a.a. ~ 327 a.a) partial recombinant protein with GST tag.
Immunogen sequence/protein sequence: QGPIDGPSKSGAEEQTSKDSPNKVVPEQPSRKDHSKPISNPSDNKELPKADTNQLADKGKLSPHAFKTESGEETDLISPPQEEVKSSEPTEDVEPKEAE
Protein accession: NP_006455
Storage buffer: 50 % glycerol
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00010618-A01-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (37 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Applications: ELISA,WB-Re
Shipping condition: Dry Ice

Reviews

Buy TGOLN2 polyclonal antibody (A01) now

Add to cart