Brand: | Abnova |
Reference: | H00010617-M01 |
Product name: | STAMBP monoclonal antibody (M01), clone 1A8 |
Product description: | Mouse monoclonal antibody raised against a full length recombinant STAMBP. |
Clone: | 1A8 |
Isotype: | IgG2a kappa |
Gene id: | 10617 |
Gene name: | STAMBP |
Gene alias: | AMSH|MGC126516|MGC126518 |
Gene description: | STAM binding protein |
Genbank accession: | BC065574 |
Immunogen: | STAMBP (AAH65574, 1 a.a. ~ 424 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | MSDHGDVSLPPEDRVRALSQLGSAVEVNEDIPPRRYFRSGVEIIRMASIYSEEGNIEHAFILYNKYITLFIEKLPKHRDYKSAVIPEKKDTVKKLKEIAFPKAEELKAELLKRYTKEYTEYNEEKKKEAEELARNMAIQQELEKEKQRVAQQKQQQLEQEQFHAFEEMIRNQELEKERLKIVQEFGKVDPGLGGPLVPDLEKPSLDVFPTLTVSSIQPSDCHTTVRPAKPPVVDRSLKPGALSNSESIPTIDGLRHVVVPGRLCPQFLQLASANTARGVETCGILCGKLMRNEFTITHVLIPKQSAGSDYCNTENEEELFLIQDQQGLITLGWIHTHPTQTAFLSSVDLHTHCSYQMMLPESVAIVCSPKFQETGFFKLTDHGLEEISSCRQKGFHPHSKDPPLFCSCSHVTVVDRAVTITDLR |
Protein accession: | AAH65574 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: |  |
Application image note: | Detection limit for recombinant GST tagged STAMBP is approximately 0.3ng/ml as a capture antibody. |
Applications: | IF,S-ELISA,ELISA |
Shipping condition: | Dry Ice |