STAMBP monoclonal antibody (M01), clone 1A8 View larger

STAMBP monoclonal antibody (M01), clone 1A8

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of STAMBP monoclonal antibody (M01), clone 1A8

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsIF,S-ELISA,ELISA

More info about STAMBP monoclonal antibody (M01), clone 1A8

Brand: Abnova
Reference: H00010617-M01
Product name: STAMBP monoclonal antibody (M01), clone 1A8
Product description: Mouse monoclonal antibody raised against a full length recombinant STAMBP.
Clone: 1A8
Isotype: IgG2a kappa
Gene id: 10617
Gene name: STAMBP
Gene alias: AMSH|MGC126516|MGC126518
Gene description: STAM binding protein
Genbank accession: BC065574
Immunogen: STAMBP (AAH65574, 1 a.a. ~ 424 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: MSDHGDVSLPPEDRVRALSQLGSAVEVNEDIPPRRYFRSGVEIIRMASIYSEEGNIEHAFILYNKYITLFIEKLPKHRDYKSAVIPEKKDTVKKLKEIAFPKAEELKAELLKRYTKEYTEYNEEKKKEAEELARNMAIQQELEKEKQRVAQQKQQQLEQEQFHAFEEMIRNQELEKERLKIVQEFGKVDPGLGGPLVPDLEKPSLDVFPTLTVSSIQPSDCHTTVRPAKPPVVDRSLKPGALSNSESIPTIDGLRHVVVPGRLCPQFLQLASANTARGVETCGILCGKLMRNEFTITHVLIPKQSAGSDYCNTENEEELFLIQDQQGLITLGWIHTHPTQTAFLSSVDLHTHCSYQMMLPESVAIVCSPKFQETGFFKLTDHGLEEISSCRQKGFHPHSKDPPLFCSCSHVTVVDRAVTITDLR
Protein accession: AAH65574
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00010617-M01-9-20-1.jpg
Application image note: Detection limit for recombinant GST tagged STAMBP is approximately 0.3ng/ml as a capture antibody.
Applications: IF,S-ELISA,ELISA
Shipping condition: Dry Ice

Reviews

Buy STAMBP monoclonal antibody (M01), clone 1A8 now

Add to cart