RBCK1 monoclonal antibody (M06), clone 1B7 View larger

RBCK1 monoclonal antibody (M06), clone 1B7

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of RBCK1 monoclonal antibody (M06), clone 1B7

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsELISA

More info about RBCK1 monoclonal antibody (M06), clone 1B7

Brand: Abnova
Reference: H00010616-M06
Product name: RBCK1 monoclonal antibody (M06), clone 1B7
Product description: Mouse monoclonal antibody raised against a partial recombinant RBCK1.
Clone: 1B7
Isotype: IgG2a Kappa
Gene id: 10616
Gene name: RBCK1
Gene alias: C20orf18|HOIL1|RBCK2|RNF54|UBCE7IP3|XAP3|XAP4|ZRANB4
Gene description: RanBP-type and C3HC4-type zinc finger containing 1
Genbank accession: NM_006462
Immunogen: RBCK1 (NP_006453, 3 a.a. ~ 99 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: TATPDGREDQERLWVSVEDAQMHTVTIWLTVRPDMTVASLKDMVFLDYGFPPVLQQWVIGQRLARDQETLHSHGVRQNGDSAYLYLLSARNTSLNPQ
Protein accession: NP_006453
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Applications: ELISA
Shipping condition: Dry Ice

Reviews

Buy RBCK1 monoclonal antibody (M06), clone 1B7 now

Add to cart