Brand: | Abnova |
Reference: | H00010616-M01 |
Product name: | C20orf18 monoclonal antibody (M01), clone 3C3 |
Product description: | Mouse monoclonal antibody raised against a partial recombinant C20orf18. |
Clone: | 3C3 |
Isotype: | IgG2b Kappa |
Gene id: | 10616 |
Gene name: | RBCK1 |
Gene alias: | C20orf18|HOIL1|RBCK2|RNF54|UBCE7IP3|XAP3|XAP4|ZRANB4 |
Gene description: | RanBP-type and C3HC4-type zinc finger containing 1 |
Genbank accession: | NM_006462 |
Immunogen: | C20orf18 (NP_006453, 3 a.a. ~ 99 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | TATPDGREDQERLWVSVEDAQMHTVTIWLTVRPDMTVASLKDMVFLDYGFPPVLQQWVIGQRLARDQETLHSHGVRQNGDSAYLYLLSARNTSLNPQ |
Protein accession: | NP_006453 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: |  |
Quality control testing picture note: | Western Blot detection against Immunogen (36.41 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: |  |
Application image note: | Detection limit for recombinant GST tagged C20orf18 is approximately 0.03ng/ml as a capture antibody. |
Applications: | IF,S-ELISA,ELISA,WB-Re,WB-Tr |
Shipping condition: | Dry Ice |