C20orf18 monoclonal antibody (M01), clone 3C3 View larger

C20orf18 monoclonal antibody (M01), clone 3C3

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of C20orf18 monoclonal antibody (M01), clone 3C3

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsIF,S-ELISA,ELISA,WB-Re,WB-Tr

More info about C20orf18 monoclonal antibody (M01), clone 3C3

Brand: Abnova
Reference: H00010616-M01
Product name: C20orf18 monoclonal antibody (M01), clone 3C3
Product description: Mouse monoclonal antibody raised against a partial recombinant C20orf18.
Clone: 3C3
Isotype: IgG2b Kappa
Gene id: 10616
Gene name: RBCK1
Gene alias: C20orf18|HOIL1|RBCK2|RNF54|UBCE7IP3|XAP3|XAP4|ZRANB4
Gene description: RanBP-type and C3HC4-type zinc finger containing 1
Genbank accession: NM_006462
Immunogen: C20orf18 (NP_006453, 3 a.a. ~ 99 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: TATPDGREDQERLWVSVEDAQMHTVTIWLTVRPDMTVASLKDMVFLDYGFPPVLQQWVIGQRLARDQETLHSHGVRQNGDSAYLYLLSARNTSLNPQ
Protein accession: NP_006453
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00010616-M01-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (36.41 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00010616-M01-9-22-1.jpg
Application image note: Detection limit for recombinant GST tagged C20orf18 is approximately 0.03ng/ml as a capture antibody.
Applications: IF,S-ELISA,ELISA,WB-Re,WB-Tr
Shipping condition: Dry Ice

Reviews

Buy C20orf18 monoclonal antibody (M01), clone 3C3 now

Add to cart