SPAG5 monoclonal antibody (M01A), clone 5F9 View larger

SPAG5 monoclonal antibody (M01A), clone 5F9

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of SPAG5 monoclonal antibody (M01A), clone 5F9

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsELISA,WB-Re

More info about SPAG5 monoclonal antibody (M01A), clone 5F9

Brand: Abnova
Reference: H00010615-M01A
Product name: SPAG5 monoclonal antibody (M01A), clone 5F9
Product description: Mouse monoclonal antibody raised against a partial recombinant SPAG5.
Clone: 5F9
Isotype: IgG3 Kappa
Gene id: 10615
Gene name: SPAG5
Gene alias: DEEPEST|MAP126|hMAP126
Gene description: sperm associated antigen 5
Genbank accession: BC000322
Immunogen: SPAG5 (AAH00322, 1082 a.a. ~ 1191 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: AETETKVLQEALAGQLDSNCQPMATNWIQEKVWLSQEVDKLRVMFLEMKNEKEKLMIKFQSHRNILEENLRRSDKELEKLDDIVQHIYKTLLSIPEVVRGCKELQGLLEF
Protein accession: AAH00322
Storage buffer: In ascites fluid
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00010615-M01A-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (37.51 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Applications: ELISA,WB-Re
Shipping condition: Dry Ice

Reviews

Buy SPAG5 monoclonal antibody (M01A), clone 5F9 now

Add to cart