SC65 monoclonal antibody (M01), clone 1E12 View larger

SC65 monoclonal antibody (M01), clone 1E12

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of SC65 monoclonal antibody (M01), clone 1E12

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsELISA,WB-Re,WB-Tr

More info about SC65 monoclonal antibody (M01), clone 1E12

Brand: Abnova
Reference: H00010609-M01
Product name: SC65 monoclonal antibody (M01), clone 1E12
Product description: Mouse monoclonal antibody raised against a partial recombinant SC65.
Clone: 1E12
Isotype: IgG2a Kappa
Gene id: 10609
Gene name: SC65
Gene alias: NOL55
Gene description: synaptonemal complex protein SC65
Genbank accession: NM_006455
Immunogen: SC65 (NP_006446, 270 a.a. ~ 379 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: QCKVDCEANLTPNVGGYFVDKFVATMYHYLQFAYYKLNDVRQAARSAASYMLFDPKDSVMQQNLVYYRFHRARWGLEEEDFQPREEAMLYHNQTAELRELLEFTHMYLQS
Protein accession: NP_006446
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00010609-M01-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (37.84 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00010609-M01-13-15-1.jpg
Application image note: Western Blot analysis of SC65 expression in transfected 293T cell line by SC65 monoclonal antibody (M01), clone 1E12.

Lane 1: SC65 transfected lysate (Predicted MW: 50.381 KDa).
Lane 2: Non-transfected lysate.
Applications: ELISA,WB-Re,WB-Tr
Shipping condition: Dry Ice

Reviews

Buy SC65 monoclonal antibody (M01), clone 1E12 now

Add to cart