PAICS monoclonal antibody (M01), clone 4F4 View larger

PAICS monoclonal antibody (M01), clone 4F4

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of PAICS monoclonal antibody (M01), clone 4F4

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsWB-Ti,S-ELISA,ELISA

More info about PAICS monoclonal antibody (M01), clone 4F4

Brand: Abnova
Reference: H00010606-M01
Product name: PAICS monoclonal antibody (M01), clone 4F4
Product description: Mouse monoclonal antibody raised against a full length recombinant PAICS.
Clone: 4F4
Isotype: IgG2a Kappa
Gene id: 10606
Gene name: PAICS
Gene alias: ADE2|ADE2H1|AIRC|DKFZp781N1372|MGC1343|MGC5024|PAIS
Gene description: phosphoribosylaminoimidazole carboxylase, phosphoribosylaminoimidazole succinocarboxamide synthetase
Genbank accession: BC010273
Immunogen: PAICS (AAH10273, 1 a.a. ~ 425 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: MATAEVLNIGKKLYEGKTKEVYELLDSPGKVLLQSKDQITAGNAARKNHLEGKAAISNKITSCIFQLLQEAGIKTAFTRKCGETAFIAPQCEMIPIEWVCRRIATGSFLKRNPGVKEGYKFYPPKVELFFKDDANNDPQWSEEQLIAAKFCFAGLLIGQTEVDIMSHATQAIFEILEKSWLPQNCTLVDMKIEFGVDVTTKEIVLADVIDNDSWRLWPSGDRSQQKDKQSYRDLKEVTPEGLQMVKKNFEWVAERVELLLKSESQCRVVVLMGSTSDLGHCEKIKKACGNFGIPCELRVTSAHKGPDETLRIKAEYEGDGIPTVFVAVAGRSNGLGPVMSGNTAYPVISCPPLTPDWGVQDVWSSLRLPSGLGCSTVLSPEGSAQFAAQIFGLSNHLVWSKLRASILNTWISLKQADKKIRECNL
Protein accession: AAH10273
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00010606-M01-2-A8-1.jpg
Application image note: PAICS monoclonal antibody (M01), clone 4F4. Western Blot analysis of PAICS expression in human placenta.
Applications: WB-Ti,S-ELISA,ELISA
Shipping condition: Dry Ice

Reviews

Buy PAICS monoclonal antibody (M01), clone 4F4 now

Add to cart