Cart 0 Product Products (empty)
No products
To be determined Shipping
0,00 € Total
Prices are tax excluded
Product successfully added to your shopping cart
Quantity
Total
There are 0 items in your cart. There is 1 item in your cart.
Total products (tax excl.)
Total shipping (tax excl.) To be determined
Total (tax excl.)
Data sheet of PAIP1 monoclonal antibody (M04A), clone 2D11
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human |
| Host species | Mouse |
| Applications | WB-Ce,ELISA,WB-Re,WB-Tr |
More info about PAIP1 monoclonal antibody (M04A), clone 2D11
| Brand: | Abnova |
| Reference: | H00010605-M04A |
| Product name: | PAIP1 monoclonal antibody (M04A), clone 2D11 |
| Product description: | Mouse monoclonal antibody raised against a partial recombinant PAIP1. |
| Clone: | 2D11 |
| Isotype: | IgG3 Kappa |
| Gene id: | 10605 |
| Gene name: | PAIP1 |
| Gene alias: | MGC12360 |
| Gene description: | poly(A) binding protein interacting protein 1 |
| Genbank accession: | NM_182789 |
| Immunogen: | PAIP1 (NP_001002, 76 a.a. ~ 185 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | YPTLSEYVQDFLNHLTEQPGSFETEIEQFAETLNGCVTTDDALQELVELIYQQATSIPNFSYMGARLCNYLSHHLTISPQSGNFRQLLLQRCRTEYEVKDQAAKGDEVTR |
| Protein accession: | NP_001002 |
| Storage buffer: | In ascites fluid |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: |  |
| Quality control testing picture note: | Western Blot detection against Immunogen (37.84 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: |  |
| Application image note: | Western Blot analysis of PAIP1 expression in transfected 293T cell line by PAIP1 monoclonal antibody (M04A), clone 2D11. Lane 1: PAIP1 transfected lysate(45.6 KDa). Lane 2: Non-transfected lysate. |
| Applications: | WB-Ce,ELISA,WB-Re,WB-Tr |
| Shipping condition: | Dry Ice |