Brand | Abnova |
Product type | Primary antibodies |
Reactivity | Human |
Host species | Mouse |
Applications | WB-Ce,ELISA,WB-Re,WB-Tr |
Brand: | Abnova |
Reference: | H00010605-M04A |
Product name: | PAIP1 monoclonal antibody (M04A), clone 2D11 |
Product description: | Mouse monoclonal antibody raised against a partial recombinant PAIP1. |
Clone: | 2D11 |
Isotype: | IgG3 Kappa |
Gene id: | 10605 |
Gene name: | PAIP1 |
Gene alias: | MGC12360 |
Gene description: | poly(A) binding protein interacting protein 1 |
Genbank accession: | NM_182789 |
Immunogen: | PAIP1 (NP_001002, 76 a.a. ~ 185 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | YPTLSEYVQDFLNHLTEQPGSFETEIEQFAETLNGCVTTDDALQELVELIYQQATSIPNFSYMGARLCNYLSHHLTISPQSGNFRQLLLQRCRTEYEVKDQAAKGDEVTR |
Protein accession: | NP_001002 |
Storage buffer: | In ascites fluid |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: | ![]() |
Quality control testing picture note: | Western Blot detection against Immunogen (37.84 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: | ![]() |
Application image note: | Western Blot analysis of PAIP1 expression in transfected 293T cell line by PAIP1 monoclonal antibody (M04A), clone 2D11. Lane 1: PAIP1 transfected lysate(45.6 KDa). Lane 2: Non-transfected lysate. |
Applications: | WB-Ce,ELISA,WB-Re,WB-Tr |
Shipping condition: | Dry Ice |