Brand: | Abnova |
Reference: | H00010588-M01 |
Product name: | MTHFS monoclonal antibody (M01), clone 2C12 |
Product description: | Mouse monoclonal antibody raised against a partial recombinant MTHFS. |
Clone: | 2C12 |
Isotype: | IgG1 Kappa |
Gene id: | 10588 |
Gene name: | MTHFS |
Gene alias: | FLJ30410|HsT19268 |
Gene description: | 5,10-methenyltetrahydrofolate synthetase (5-formyltetrahydrofolate cyclo-ligase) |
Genbank accession: | NM_006441 |
Immunogen: | MTHFS (NP_006432, 104 a.a. ~ 203 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | LPKTSWNIPQPGEGDVREEALSTGGLDLIFMPGLGFDKHGNRLGRGKGYYDAYLKRCLQHQEVKPYTLALAFKEQICLQVPVNENDMKVDEVLYEDSSTA |
Protein accession: | NP_006432 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: |  |
Quality control testing picture note: | Western Blot detection against Immunogen (36.74 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: |  |
Application image note: | MTHFS monoclonal antibody (M01), clone 2C12 Western Blot analysis of MTHFS expression in HeLa ( Cat # L013V1 ). |
Applications: | WB-Ce,ELISA,WB-Re |
Shipping condition: | Dry Ice |