MTHFS monoclonal antibody (M01), clone 2C12 View larger

MTHFS monoclonal antibody (M01), clone 2C12

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of MTHFS monoclonal antibody (M01), clone 2C12

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsWB-Ce,ELISA,WB-Re

More info about MTHFS monoclonal antibody (M01), clone 2C12

Brand: Abnova
Reference: H00010588-M01
Product name: MTHFS monoclonal antibody (M01), clone 2C12
Product description: Mouse monoclonal antibody raised against a partial recombinant MTHFS.
Clone: 2C12
Isotype: IgG1 Kappa
Gene id: 10588
Gene name: MTHFS
Gene alias: FLJ30410|HsT19268
Gene description: 5,10-methenyltetrahydrofolate synthetase (5-formyltetrahydrofolate cyclo-ligase)
Genbank accession: NM_006441
Immunogen: MTHFS (NP_006432, 104 a.a. ~ 203 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: LPKTSWNIPQPGEGDVREEALSTGGLDLIFMPGLGFDKHGNRLGRGKGYYDAYLKRCLQHQEVKPYTLALAFKEQICLQVPVNENDMKVDEVLYEDSSTA
Protein accession: NP_006432
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00010588-M01-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (36.74 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00010588-M01-1-1-1.jpg
Application image note: MTHFS monoclonal antibody (M01), clone 2C12 Western Blot analysis of MTHFS expression in HeLa ( Cat # L013V1 ).
Applications: WB-Ce,ELISA,WB-Re
Shipping condition: Dry Ice

Reviews

Buy MTHFS monoclonal antibody (M01), clone 2C12 now

Add to cart