Brand: | Abnova |
Reference: | H00010581-M14 |
Product name: | IFITM2 monoclonal antibody (M14), clone 1F2 |
Product description: | Mouse monoclonal antibody raised against a partial recombinant IFITM2. |
Clone: | 1F2 |
Isotype: | IgG2a Kappa |
Gene id: | 10581 |
Gene name: | IFITM2 |
Gene alias: | 1-8D |
Gene description: | interferon induced transmembrane protein 2 (1-8D) |
Genbank accession: | NM_006435 |
Immunogen: | IFITM2 (NP_006426.1, 1 a.a. ~ 59 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | MNHIVQTFSPVNSGQPPNYEMLKEEQEVAMLGAPHNPAPPTSTVIHIRSETSVPDHVVW |
Protein accession: | NP_006426.1 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: |  |
Quality control testing picture note: | Western Blot detection against Immunogen (32.23 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: |  |
Application image note: | IFITM2 monoclonal antibody (M14), clone 1F2. Western Blot analysis of IFITM2 expression in HepG2(Cat # L019V1 ). |
Applications: | WB-Ce,S-ELISA,ELISA,WB-Re,WB-Tr |
Shipping condition: | Dry Ice |