IFITM2 monoclonal antibody (M14), clone 1F2 View larger

IFITM2 monoclonal antibody (M14), clone 1F2

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of IFITM2 monoclonal antibody (M14), clone 1F2

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsWB-Ce,S-ELISA,ELISA,WB-Re,WB-Tr

More info about IFITM2 monoclonal antibody (M14), clone 1F2

Brand: Abnova
Reference: H00010581-M14
Product name: IFITM2 monoclonal antibody (M14), clone 1F2
Product description: Mouse monoclonal antibody raised against a partial recombinant IFITM2.
Clone: 1F2
Isotype: IgG2a Kappa
Gene id: 10581
Gene name: IFITM2
Gene alias: 1-8D
Gene description: interferon induced transmembrane protein 2 (1-8D)
Genbank accession: NM_006435
Immunogen: IFITM2 (NP_006426.1, 1 a.a. ~ 59 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: MNHIVQTFSPVNSGQPPNYEMLKEEQEVAMLGAPHNPAPPTSTVIHIRSETSVPDHVVW
Protein accession: NP_006426.1
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00010581-M14-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (32.23 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00010581-M14-1-12-1.jpg
Application image note: IFITM2 monoclonal antibody (M14), clone 1F2. Western Blot analysis of IFITM2 expression in HepG2(Cat # L019V1 ).
Applications: WB-Ce,S-ELISA,ELISA,WB-Re,WB-Tr
Shipping condition: Dry Ice

Reviews

Buy IFITM2 monoclonal antibody (M14), clone 1F2 now

Add to cart