CCT7 monoclonal antibody (M02), clone 3A6 View larger

CCT7 monoclonal antibody (M02), clone 3A6

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of CCT7 monoclonal antibody (M02), clone 3A6

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsS-ELISA,ELISA,WB-Re

More info about CCT7 monoclonal antibody (M02), clone 3A6

Brand: Abnova
Reference: H00010574-M02
Product name: CCT7 monoclonal antibody (M02), clone 3A6
Product description: Mouse monoclonal antibody raised against a partial recombinant CCT7.
Clone: 3A6
Isotype: IgG2a Kappa
Gene id: 10574
Gene name: CCT7
Gene alias: CCT-ETA|Ccth|MGC110985|Nip7-1|TCP-1-eta
Gene description: chaperonin containing TCP1, subunit 7 (eta)
Genbank accession: BC019296
Immunogen: CCT7 (AAH19296, 425 a.a. ~ 528 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: RTIPGKQQLLIGAYAKALEIIPRQLCDNAGFDATNILNKLRARHAQGGTWYGVDINNEDIADNFEAFVWEPAMVRINALTAASEAACLIVSVDETIKNPRSTVD
Protein accession: AAH19296
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00010574-M02-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (37.07 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00010574-M02-9-20-1.jpg
Application image note: Detection limit for recombinant GST tagged CCT7 is approximately 0.3ng/ml as a capture antibody.
Applications: S-ELISA,ELISA,WB-Re
Shipping condition: Dry Ice
Publications: Reconstitution of the human chaperonin CCT by co-expression of the eight distinct subunits in mammalian cells.Machida K, Masutani M, Kobayashi T, Mikami S, Nishino Y, Miyazawa A, Imataka H.
Protein Expr Purif. 2011 Nov 22.

Reviews

Buy CCT7 monoclonal antibody (M02), clone 3A6 now

Add to cart