Brand: | Abnova |
Reference: | H00010570-M01 |
Product name: | DPYSL4 monoclonal antibody (M01), clone 1F5 |
Product description: | Mouse monoclonal antibody raised against a partial recombinant DPYSL4. |
Clone: | 1F5 |
Isotype: | IgG2b Kappa |
Gene id: | 10570 |
Gene name: | DPYSL4 |
Gene alias: | CRMP3|DRP-4|ULIP4 |
Gene description: | dihydropyrimidinase-like 4 |
Genbank accession: | NM_006426 |
Immunogen: | DPYSL4 (NP_006417, 461 a.a. ~ 559 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | VTPGAGRFVPRKTFPDFVYKRIKARNRLAEIHGVPRGLYDGPVHEVMVPAKPGSGAPARASCPGKISVPPVRNLHQSGFSLSGSQADDHIARRTAQKIM |
Protein accession: | NP_006417 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: |  |
Quality control testing picture note: | Western Blot detection against Immunogen (36.63 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: |  |
Application image note: | Detection limit for recombinant GST tagged DPYSL4 is 1 ng/ml as a capture antibody. |
Applications: | S-ELISA,ELISA,WB-Re,WB-Tr,IP |
Shipping condition: | Dry Ice |