Cart 0 Product Products (empty)
No products
To be determined Shipping
0,00 € Total
Prices are tax excluded
Product successfully added to your shopping cart
Quantity
Total
There are 0 items in your cart. There is 1 item in your cart.
Total products (tax excl.)
Total shipping (tax excl.) To be determined
Total (tax excl.)
Data sheet of DPYSL4 polyclonal antibody (A01)
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human |
| Host species | Mouse |
| Applications | WB-Ce,ELISA,WB-Re |
More info about DPYSL4 polyclonal antibody (A01)
| Brand: | Abnova |
| Reference: | H00010570-A01 |
| Product name: | DPYSL4 polyclonal antibody (A01) |
| Product description: | Mouse polyclonal antibody raised against a partial recombinant DPYSL4. |
| Gene id: | 10570 |
| Gene name: | DPYSL4 |
| Gene alias: | CRMP3|DRP-4|ULIP4 |
| Gene description: | dihydropyrimidinase-like 4 |
| Genbank accession: | NM_006426 |
| Immunogen: | DPYSL4 (NP_006417, 461 a.a. ~ 559 a.a) partial recombinant protein with GST tag. |
| Immunogen sequence/protein sequence: | VTPGAGRFVPRKTFPDFVYKRIKARNRLAEIHGVPRGLYDGPVHEVMVPAKPGSGAPARASCPGKISVPPVRNLHQSGFSLSGSQADDHIARRTAQKIM |
| Protein accession: | NP_006417 |
| Storage buffer: | 50 % glycerol |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: |  |
| Quality control testing picture note: | Western Blot detection against Immunogen (37 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: |  |
| Application image note: | DPYSL4 polyclonal antibody (A01), Lot # 051206JCO1 Western Blot analysis of DPYSL4 expression in IMR-32 ( Cat # L008V1 ). |
| Applications: | WB-Ce,ELISA,WB-Re |
| Shipping condition: | Dry Ice |
| Publications: | Identification of dihydropyrimidinase-related protein 4 as a novel target of the p53 tumor suppressor in the apoptotic response to DNA damage.Kimura J, Kudoh T, Miki Y, Yoshida K. Int J Cancer. 2011 Apr 1;128(7):1524-31. doi: 10.1002/ijc.25475. Epub 2010 May 24. |