ARFGEF1 monoclonal antibody (M02), clone 3E11 View larger

ARFGEF1 monoclonal antibody (M02), clone 3E11

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of ARFGEF1 monoclonal antibody (M02), clone 3E11

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsS-ELISA,ELISA,WB-Re

More info about ARFGEF1 monoclonal antibody (M02), clone 3E11

Brand: Abnova
Reference: H00010565-M02
Product name: ARFGEF1 monoclonal antibody (M02), clone 3E11
Product description: Mouse monoclonal antibody raised against a partial recombinant ARFGEF1.
Clone: 3E11
Isotype: IgG2a Kappa
Gene id: 10565
Gene name: ARFGEF1
Gene alias: ARFGEP1|BIG1|D730028O18Rik|DKFZP434L057|P200
Gene description: ADP-ribosylation factor guanine nucleotide-exchange factor 1(brefeldin A-inhibited)
Genbank accession: NM_006421
Immunogen: ARFGEF1 (NP_006412.2, 311 a.a. ~ 411 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: EVLYDGENHDCEEKPQDIVQNIVEEMVNIVVGDMGEGTTINASADGNIGTIEDGSDSENIQANGIPGTPISVAYTPSLPDDRLSVSSNDTQESGNSSGPSP
Protein accession: NP_006412.2
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00010565-M02-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (36.85 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00010565-M02-9-21-1.jpg
Application image note: Detection limit for recombinant GST tagged ARFGEF1 is 0.1 ng/ml as a capture antibody.
Applications: S-ELISA,ELISA,WB-Re
Shipping condition: Dry Ice

Reviews

Buy ARFGEF1 monoclonal antibody (M02), clone 3E11 now

Add to cart