Brand: | Abnova |
Reference: | H00010565-M02 |
Product name: | ARFGEF1 monoclonal antibody (M02), clone 3E11 |
Product description: | Mouse monoclonal antibody raised against a partial recombinant ARFGEF1. |
Clone: | 3E11 |
Isotype: | IgG2a Kappa |
Gene id: | 10565 |
Gene name: | ARFGEF1 |
Gene alias: | ARFGEP1|BIG1|D730028O18Rik|DKFZP434L057|P200 |
Gene description: | ADP-ribosylation factor guanine nucleotide-exchange factor 1(brefeldin A-inhibited) |
Genbank accession: | NM_006421 |
Immunogen: | ARFGEF1 (NP_006412.2, 311 a.a. ~ 411 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | EVLYDGENHDCEEKPQDIVQNIVEEMVNIVVGDMGEGTTINASADGNIGTIEDGSDSENIQANGIPGTPISVAYTPSLPDDRLSVSSNDTQESGNSSGPSP |
Protein accession: | NP_006412.2 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: |  |
Quality control testing picture note: | Western Blot detection against Immunogen (36.85 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: |  |
Application image note: | Detection limit for recombinant GST tagged ARFGEF1 is 0.1 ng/ml as a capture antibody. |
Applications: | S-ELISA,ELISA,WB-Re |
Shipping condition: | Dry Ice |