SLC19A2 monoclonal antibody (M10), clone 5B10 View larger

SLC19A2 monoclonal antibody (M10), clone 5B10

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of SLC19A2 monoclonal antibody (M10), clone 5B10

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsWB-Ti,S-ELISA,ELISA,WB-Re

More info about SLC19A2 monoclonal antibody (M10), clone 5B10

Brand: Abnova
Reference: H00010560-M10
Product name: SLC19A2 monoclonal antibody (M10), clone 5B10
Product description: Mouse monoclonal antibody raised against a partial recombinant SLC19A2.
Clone: 5B10
Isotype: IgG2a Kappa
Gene id: 10560
Gene name: SLC19A2
Gene alias: TC1|THT1|THTR1|TRMA
Gene description: solute carrier family 19 (thiamine transporter), member 2
Genbank accession: NM_006996.1
Immunogen: SLC19A2 (NP_008927.1, 209 a.a. ~ 285 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: PMPQKSLFFHHIPSTCQRVNGIKVQNGGIVTDTPASNHLPGWEDIESKIPLNMEEPPVEEPEPKPDRLLVLKVLWND
Protein accession: NP_008927.1
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00010560-M10-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (34.21 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00010560-M10-9-21-1.jpg
Application image note: Detection limit for recombinant GST tagged SLC19A2 is approximately 0.1ng/ml as a capture antibody.
Applications: WB-Ti,S-ELISA,ELISA,WB-Re
Shipping condition: Dry Ice

Reviews

Buy SLC19A2 monoclonal antibody (M10), clone 5B10 now

Add to cart