H00010558-M09_100ug
New product
Availability date:
Brand | Abnova |
Product type | Primary antibodies |
Reactivity | Human |
Host species | Mouse |
Applications | S-ELISA,ELISA,WB-Re |
Brand: | Abnova |
Reference: | H00010558-M09 |
Product name: | SPTLC1 monoclonal antibody (M09), clone 3D11 |
Product description: | Mouse monoclonal antibody raised against a full-length recombinant SPTLC1. |
Clone: | 3D11 |
Isotype: | IgG2a Kappa |
Gene id: | 10558 |
Gene name: | SPTLC1 |
Gene alias: | HSAN|HSAN1|HSN1|LBC1|LCB1|MGC14645|SPT1|SPTI |
Gene description: | serine palmitoyltransferase, long chain base subunit 1 |
Genbank accession: | BC007085 |
Immunogen: | SPTLC1 (AAH07085, 43 a.a. ~ 143 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | TYKLQERSDLTVKEKEELIEEWQPEPLVPPVPKDHPALNYNIVSGPPSHKTVVNGKECINFASFNFLGLLDNPRVKAATLASLKKYGVGTCGPRGFYGTFE |
Protein accession: | AAH07085 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: | ![]() |
Quality control testing picture note: | Western Blot detection against Immunogen (36.85 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: | ![]() |
Application image note: | Detection limit for recombinant GST tagged SPTLC1 is 0.3 ng/ml as a capture antibody. |
Applications: | S-ELISA,ELISA,WB-Re |
Shipping condition: | Dry Ice |