HTATIP2 MaxPab mouse polyclonal antibody (B01) View larger

HTATIP2 MaxPab mouse polyclonal antibody (B01)

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of HTATIP2 MaxPab mouse polyclonal antibody (B01)

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsWB-Tr

More info about HTATIP2 MaxPab mouse polyclonal antibody (B01)

Brand: Abnova
Reference: H00010553-B01
Product name: HTATIP2 MaxPab mouse polyclonal antibody (B01)
Product description: Mouse polyclonal antibody raised against a full-length human HTATIP2 protein.
Gene id: 10553
Gene name: HTATIP2
Gene alias: CC3|FLJ26963|SDR44U1|TIP30
Gene description: HIV-1 Tat interactive protein 2, 30kDa
Genbank accession: NM_006410.3
Immunogen: HTATIP2 (NP_006401.2, 1 a.a. ~ 242 a.a) full-length human protein.
Immunogen sequence/protein sequence: MAETEALSKLREDFRMQNKSVFILGASGETGRVLLKEILEQGLFSKVTLIGRRKLTFDEEAYKNVNQEVVDFEKLDDYASAFQGHDVGFCCLGTTRGKAGAEGFVRVDRDYVLKSAELAKAGGCKHFNLLSSKGADKSSNFLYLQVKGEVEAKVEELKFDRYSVFRPGVLLCDRQESRPGEWLVRKFFGSLPDSWARGHSVPVVTVVRAMLNNVVRPRDKQMELLENKAIHDLGKAHGSLKP
Protein accession: NP_006401.2
Storage buffer: No additive
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody reactive against mammalian transfected lysate.
Note: For IHC and IF applications, antibody purification with Protein A will be needed prior to use.
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00010553-B01-13-15-1.jpg
Application image note: Western Blot analysis of HTATIP2 expression in transfected 293T cell line (H00010553-T01) by HTATIP2 MaxPab polyclonal antibody.

Lane 1: HTATIP2 transfected lysate(27.10 KDa).
Lane 2: Non-transfected lysate.
Applications: WB-Tr
Shipping condition: Dry Ice

Reviews

Buy HTATIP2 MaxPab mouse polyclonal antibody (B01) now

Add to cart