Brand: | Abnova |
Reference: | H00010551-M05A |
Product name: | AGR2 monoclonal antibody (M05A), clone 1C9 |
Product description: | Mouse monoclonal antibody raised against a full-length recombinant AGR2. |
Clone: | 1C9 |
Isotype: | IgG2b Kappa |
Gene id: | 10551 |
Gene name: | AGR2 |
Gene alias: | AG2|GOB-4|HAG-2|XAG-2 |
Gene description: | anterior gradient homolog 2 (Xenopus laevis) |
Genbank accession: | BC015503 |
Immunogen: | AGR2 (AAH15503.1, 1 a.a. ~ 175 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | MEKIPVSAFLLLVALSYTLARDTTVKPGAKKDTKDSRPKLPQTLSRGWGDQLIWTQTYEEALYKSKTSNKPLMIIHHLDECPHSQALKKVFAENKEIQKLAEQFVLLNLVYETTDKHLSPDGQYVPRIMFVDPSLTVRADITGRYSNRLYAYEPADTALLLDNMKKALKLLKTEL |
Protein accession: | AAH15503.1 |
Storage buffer: | In ascites fluid |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: |  |
Quality control testing picture note: | Western Blot detection against Immunogen (44.99 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: |  |
Application image note: | AGR2 monoclonal antibody (M05A), clone 1C9. Western Blot analysis of AGR2 expression in human colon. |
Applications: | WB-Ti,ELISA,WB-Re,WB-Tr |
Shipping condition: | Dry Ice |