Cart 0 Product Products (empty)
No products
To be determined Shipping
0,00 € Total
Prices are tax excluded
Product successfully added to your shopping cart
Quantity
Total
There are 0 items in your cart. There is 1 item in your cart.
Total products (tax excl.)
Total shipping (tax excl.) To be determined
Total (tax excl.)
Data sheet of AGR2 monoclonal antibody (M03), clone 1C3
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human |
| Host species | Mouse |
| Applications | WB-Ce,S-ELISA,ELISA,WB-Re,WB-Tr |
More info about AGR2 monoclonal antibody (M03), clone 1C3
| Brand: | Abnova |
| Reference: | H00010551-M03 |
| Product name: | AGR2 monoclonal antibody (M03), clone 1C3 |
| Product description: | Mouse monoclonal antibody raised against a full length recombinant AGR2. |
| Clone: | 1C3 |
| Isotype: | IgG2b Kappa |
| Gene id: | 10551 |
| Gene name: | AGR2 |
| Gene alias: | AG2|GOB-4|HAG-2|XAG-2 |
| Gene description: | anterior gradient homolog 2 (Xenopus laevis) |
| Genbank accession: | BC015503 |
| Immunogen: | AGR2 (AAH15503.1, 1 a.a. ~ 175 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | MEKIPVSAFLLLVALSYTLARDTTVKPGAKKDTKDSRPKLPQTLSRGWGDQLIWTQTYEEALYKSKTSNKPLMIIHHLDECPHSQALKKVFAENKEIQKLAEQFVLLNLVYETTDKHLSPDGQYVPRIMFVDPSLTVRADITGRYSNRLYAYEPADTALLLDNMKKALKLLKTEL |
| Protein accession: | AAH15503.1 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: |  |
| Quality control testing picture note: | Western Blot detection against Immunogen (44.99 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: |  |
| Application image note: | AGR2 monoclonal antibody (M03), clone 1C3 Western Blot analysis of AGR2 expression in MCF-7 ( Cat # L046V1 ). |
| Applications: | WB-Ce,S-ELISA,ELISA,WB-Re,WB-Tr |
| Shipping condition: | Dry Ice |
| Publications: | Identification of Candidate Biomarkers of Therapeutic Response to Docetaxel by Proteomic Profiling.Zhao L, Lee BY, Brown DA, Molloy MP, Marx GM, Pavlakis N, Boyer MJ, Stockler MR, Kaplan W, Breit SN, Sutherland RL, Henshall SM, Horvath LG. Cancer Res. 2009 Oct 1;69(19):7696-703. Epub 2009 Sep 22. |