AGR2 monoclonal antibody (M01), clone 1E5 View larger

AGR2 monoclonal antibody (M01), clone 1E5

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of AGR2 monoclonal antibody (M01), clone 1E5

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsWB-Ce,WB-Ti,S-ELISA,ELISA,WB-Re,WB-Tr

More info about AGR2 monoclonal antibody (M01), clone 1E5

Brand: Abnova
Reference: H00010551-M01
Product name: AGR2 monoclonal antibody (M01), clone 1E5
Product description: Mouse monoclonal antibody raised against a full-length recombinant AGR2.
Clone: 1E5
Isotype: IgG2b Kappa
Gene id: 10551
Gene name: AGR2
Gene alias: AG2|GOB-4|HAG-2|XAG-2
Gene description: anterior gradient homolog 2 (Xenopus laevis)
Genbank accession: BC015503
Immunogen: AGR2 (AAH15503.1, 1 a.a. ~ 175 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: MEKIPVSAFLLLVALSYTLARDTTVKPGAKKDTKDSRPKLPQTLSRGWGDQLIWTQTYEEALYKSKTSNKPLMIIHHLDECPHSQALKKVFAENKEIQKLAEQFVLLNLVYETTDKHLSPDGQYVPRIMFVDPSLTVRADITGRYSNRLYAYEPADTALLLDNMKKALKLLKTEL
Protein accession: AAH15503.1
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00010551-M01-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (44.99 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00010551-M01-1-7-1.jpg
Application image note: AGR2 monoclonal antibody (M01), clone 1E5. Western Blot analysis of AGR2 expression in MCF-7 ( Cat # L046V1 ).
Applications: WB-Ce,WB-Ti,S-ELISA,ELISA,WB-Re,WB-Tr
Shipping condition: Dry Ice
Publications: AGR2, an Endoplasmic Reticulum Protein, Is Secreted into the Gastrointestinal Mucus.Bergstrom JH, Berg KA, Rodriguez-Pineiro AM, Stecher B, Johansson ME, Hansson GC
PLoS One. 2014 Aug 11;9(8):e104186. doi: 10.1371/journal.pone.0104186. eCollection 2014.

Reviews

Buy AGR2 monoclonal antibody (M01), clone 1E5 now

Add to cart