ARL6IP5 polyclonal antibody (A01) View larger

ARL6IP5 polyclonal antibody (A01)

New product

286,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of ARL6IP5 polyclonal antibody (A01)

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsELISA,WB-Re

More info about ARL6IP5 polyclonal antibody (A01)

Brand: Abnova
Reference: H00010550-A01
Product name: ARL6IP5 polyclonal antibody (A01)
Product description: Mouse polyclonal antibody raised against a partial recombinant ARL6IP5.
Gene id: 10550
Gene name: ARL6IP5
Gene alias: DERP11|GTRAP3-18|HSPC127|JWA|PRAF3|addicsin|hp22|jmx
Gene description: ADP-ribosylation-like factor 6 interacting protein 5
Genbank accession: NM_006407
Immunogen: ARL6IP5 (NP_006398, 1 a.a. ~ 64 a.a) partial recombinant protein with GST tag.
Immunogen sequence/protein sequence: MDVNIAPLRAWDDFFPGSDRFARPDFRDISKWNNRVVSNLLYYQTNYLVVAAMMISIVGFLSPF
Protein accession: NP_006398
Storage buffer: 50 % glycerol
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00010550-A01-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (33.15 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Applications: ELISA,WB-Re
Shipping condition: Dry Ice

Reviews

Buy ARL6IP5 polyclonal antibody (A01) now

Add to cart