Brand: | Abnova |
Reference: | H00010540-M01 |
Product name: | DCTN2 monoclonal antibody (M01), clone 2G7 |
Product description: | Mouse monoclonal antibody raised against a partial recombinant DCTN2. |
Clone: | 2G7 |
Isotype: | IgG1 lambda |
Gene id: | 10540 |
Gene name: | DCTN2 |
Gene alias: | DCTN50|DYNAMITIN|RBP50 |
Gene description: | dynactin 2 (p50) |
Genbank accession: | BC000718 |
Immunogen: | DCTN2 (AAH00718, 302 a.a. ~ 401 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | DADTQSKVHQLYETIQRWSPIASTLPELVQRLVTIKQLHEQAMQFGQLLTHLDTTQQMIANSLKDNTTLLTQVQTTMRENLATVEGNFASIDERMKKLGK |
Protein accession: | AAH00718 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: |  |
Quality control testing picture note: | Western Blot detection against Immunogen (36.63 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: |  |
Application image note: | Immunofluorescence of monoclonal antibody to DCTN2 on MCF-7 cell . [antibody concentration 10 ug/ml] |
Applications: | WB-Ce,IF,S-ELISA,ELISA,WB-Re |
Shipping condition: | Dry Ice |